SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013246 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013246
Domain Number 1 Region: 172-251
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000104
Family DEATH domain, DD 0.014
Further Details:      
 
Domain Number 2 Region: 27-124
Classification Level Classification E-value
Superfamily EF-hand 0.0000000205
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013246   Gene: ENSLOCG00000010808   Transcript: ENSLOCT00000013274
Sequence length 253
Comment pep:novel chromosome:LepOcu1:LG2:43367350:43377902:-1 gene:ENSLOCG00000010808 transcript:ENSLOCT00000013274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIYSSTFYKSGDQILFESTDPSQANWITAHADACKLTIPEVLRCWERFLMLHPDKNGNI
LRHSLTTNDAFNSQLVEQLPVSEDGLVTFQTFCCAVKWLSSSVTETKLRGFIDEDDFILW
LKRLPVETLKSSLHFPVLPNKTTVTGHRTNTKHFTARTRVESTAVQKLTYNQLHVIAVEL
SKRRRDWKLLANCLGFLEKDCQTLERKYLDTENQILEMLQLWRRRAQVPDAAKHLQAALR
DTGNADISNAVFQ
Download sequence
Identical sequences W5MXY7
ENSLOCP00000013246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]