SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014039 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014039
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-81
Family Protein kinases, catalytic subunit 0.00000000054
Further Details:      
 
Domain Number 2 Region: 369-662
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.04e-77
Family Ankyrin repeat 0.0000142
Further Details:      
 
Domain Number 3 Region: 1288-1396
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000011
Family DEATH domain, DD 0.0045
Further Details:      
 
Domain Number 4 Region: 674-708,781-891
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000015
Family G proteins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014039   Gene: ENSLOCG00000011423   Transcript: ENSLOCT00000014068
Sequence length 1431
Comment pep:known_by_projection chromosome:LepOcu1:LG2:47080910:47153173:1 gene:ENSLOCG00000011423 transcript:ENSLOCT00000014068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFKQENVEDYYEIGEELGSGQFAVVKKCREKSTGVEYAAKSIKKRRSKSSRRGVTKED
IEREVSILKEIQHPNVITLHDVYENKTDVILILELVAGGELFDFLAEKESLSEEEATEFL
KQILDGVFYLHSKQIAHFDLKPENIMLLNRNVPHPRIKLIDFGLAHKIDFGNDFKNIFGT
PEFVAPEVVNYEPLGLEADMWSVGVITYILLSGASPFLGDNKQETLANVSAVNYEFDEEF
FSNTSNLAKDFIRRLLIKDPKKRMTIQDSLHHPWIKPKDTQQALSRKESAVNVEKLKKFA
ARRKWKQSVRLISLCNRLSRSFLSRSNISVARSDDTLDDEDSFVMKAIIHAINDDNVPGL
QHLLGSLTSYDINQPNKHGTPPLLIAAACGNIQILDLLMKKGAEIQAQDKCGANAIYYAA
RNSHVETLKFLNERKCPLDVQDKSGETALHVAARYGNVDVVQYLCSIQANPNVRDKEQET
PLHCAAWHGYYPVAKVLCEAGCDVNVKNKEGETPLLTASSRGYRDIVECLLDHDADLDST
DKDGHIALHLAVRRCQIDVVKCLISHGCYVDVQDRHGNTPLHIACKDGNVPILLSLCDAK
CSLDIPNKYGRTPLHLAANNGCLDAVRYLCVAGANIDAVTNDGKTAEDLARNEQHEHIAI
LLGRLKKDAHKGSFIQQLRPTQNPQPRIKLKLFGHSGSGKTTLLESLRCGILRSFFRRRR
PRLSSTNSSRFPPSPMSSKPTVSVSISNLYPGCENVSVRSRSMMFEPSLTKGVLEVFSPM
HNSSAADDQSTKAIEIQNANINGVGDFNVWEFSGNPVYYCSYDYFAANDTTAVHVILFSL
EEPYETQLNQVTFWLNFLKSLILPEEPIAFGGRIKNPLRVVLVATHADIVNLPRAFGGEF
GYDKELSLLKEVRTRFGNDLQISERLFVLDAGASNSKDMKLLRNHLQELRNVIISSCPPM
TLLCEKIISTLPAWRKMNGPNQLMSWQQFVFDIQEQINPLISEDDLRDLALQLHSMGELN
IMQSETIQDVVLLDPRWLCTCVIGKILSVETPKAIHHYRGRYRIEEVQSLVSENDVDELI
QILDAMDICARDLTNPTMVDIPALIKTNGMHRSWTEEDEEDEVLVYGGVRIVPVEHLTPF
PCGIFHKLQVNLCRWSHQQKPEGDDIRLWTNGVKIAHGGAEVMVLLVNHGQGIEVQVRGM
DPEKIKCYMLLDLICSIIDNLMATTVPGLLTVKYYLSPQQLREHHEPIMVYQPRDFLRAQ
TQREASLANTMGGYKESFSSILSFGCAEVYHQGSLGMDIHMSDTSLLVRRKLSRLLDPPD
SMGKDWCLLAMNLGLTDLVAKYSTQNGTQEEDVFHSSPTAVLIQEWSTNPESTVGIFMAK
LRELGRRDAADFLLKSSTVFKVNLDVNGQETYGTTCNGGTSYNSISSVISR
Download sequence
Identical sequences W5N080
XP_015195615.1.81211 XP_015195616.1.81211 XP_015195617.1.81211 XP_015195618.1.81211 ENSLOCP00000014039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]