SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014060 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014060
Domain Number 1 Region: 129-372
Classification Level Classification E-value
Superfamily vWA-like 5.68e-73
Family Integrin A (or I) domain 0.000000514
Further Details:      
 
Domain Number 2 Region: 385-460
Classification Level Classification E-value
Superfamily Integrin domains 4.08e-18
Family Integrin domains 0.00094
Further Details:      
 
Domain Number 3 Region: 32-89
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000994
Family Plexin repeat 0.00097
Further Details:      
 
Domain Number 4 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family Integrin beta EGF-like domains 0.034
Further Details:      
 
Domain Number 5 Region: 580-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family Integrin beta EGF-like domains 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000014060
Domain Number - Region: 507-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014060   Gene: ENSLOCG00000011431   Transcript: ENSLOCT00000014089
Sequence length 767
Comment pep:known_by_projection chromosome:LepOcu1:LG11:39936968:39960216:1 gene:ENSLOCG00000011431 transcript:ENSLOCT00000014089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQNCSFNMPAKIPLCLTSASLICLFSCVPAANSCTAPHISSCKECLKQGAECGWCFQEGF
LDGAPVSERCDLISNLEKKGCALDFIERPSVKVVVDASTSSTQVTPRDVTVQLWPGREAS
FVLQVRQLERYPVDMYYLVDVSASMQDNLDKLKTVGIALSEKMKEHSTDFKVGFGSFVDK
PVSPYINVHPSKIDNPCSDYDIQCRPAHGFIHVLSLTDNITEFTRVVHEQHISGNMDTPE
GGFDAMLQAAVCQNHIGWRSEAKHLLLMMTDQPSHLALDSKLAGIVVPHDGNCHLEDNTY
TQSAYMEHPTIGQLADKLLENSVHSIFAVEELQYKWYEDLIPLMPGTFVGKLQPKASNLK
DLVVQAYKRLLSDVEVQILVQNQVQKLAVNITALCPGGNPVPGHNKCSNVKPNETVFFNI
TIGMRECGNQGEAVDFLIKPVGFNESTRVKVQTACACQCTGPGAPSSGRCWNERSPQDCR
SSETGSCTCEQGGEEGGLGESCRLDDTQPACSGRGSCLCGRCVCARSSLGLVFGKYCEMD
NFSCSYHRGLLCGGHGQCVLGECRCASGWEGESCSCPTSTEPCMPTGSGVCSGKGRCVCG
RCQCEDPRRSGRFCEVCPMCNNPCETNWKCVQCHLSSDFSEVKATQCNATCFPMVHYIDD
ISECLSEQQYFPTFTAVFLITIALGLMLILILKYILARKNRRRDVSSDAVNDVSPKDMSY
LPTMNEKTITYRRDRPVEMRIHVHKMPLNEIWQCEKDDLYDRAFIHH
Download sequence
Identical sequences W5N0A1
ENSLOCP00000014060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]