SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014255 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014255
Domain Number 1 Region: 88-251
Classification Level Classification E-value
Superfamily RUN domain-like 2.48e-52
Family RUN domain 0.0000000443
Further Details:      
 
Domain Number 2 Region: 549-648
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000139
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000014255
Domain Number - Region: 281-384
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00183
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 454-563
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0956
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014255   Gene: ENSLOCG00000011601   Transcript: ENSLOCT00000014284
Sequence length 657
Comment pep:known_by_projection chromosome:LepOcu1:LG2:48164055:48188851:-1 gene:ENSLOCG00000011601 transcript:ENSLOCT00000014284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLTPQSDAPTPTTDKITQAARETIYLCNFRVSVDGEWLCLRELNDISLTPDPEPAHED
SWEDFTDLLEQMQMLDEFEDPKDPIAIERLNLMNMAKLSIKGLIESALNLGRTLDSDYAP
LQQFFVVMEHCLKHGLKTKKTFLGQNKSFWGPLELVEKLTPEAGEITASVKDLPGLKTPI
GRGRAWLRLALMQKKLSDYMKTLINRKDLLSEFYEPNALMMEEEGAVIAGLLVGLNVIDA
NLCMKGEDLDSQVGVIDFSMYLKDGGHSSKSTEGDGQITAILDQKNYVEELNRHLSASVN
NLQAKVDALEKSNTKLTEELAVANNRIITMQEEVERVKEESSYLLESNRKVSKVDGSADG
QVLGETRKQLKEETQLRLDVEKELEVQIGMKQEMELSMKMLEKDICEKQDALVALRQQLD
DLRTLNHELSHKSQSSDTALKQKSDIISRLEEKANQMAGTIKVLEQRSRQAERERDLAEE
ANRLFKKEFGDKIESLQLEIEQLRKQRSVLELEKRERERKTGLHIESVAVDIKASPPVKN
YKQQMKDIKRELQAVKEENVKLRTVLDGKESLNSSLSSQTEEEQDQSSTKNSQPSLCRLC
KEEDSLARVKKQCNNCREDFCENCLANELPLPSSINPVQVCTVCHKKLLKQYSSSPV
Download sequence
Identical sequences W5N0U6
ENSLOCP00000014255 XP_015195111.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]