SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014256 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014256
Domain Number 1 Region: 185-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000432
Family RecA protein-like (ATPase-domain) 0.079
Further Details:      
 
Domain Number 2 Region: 16-84
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000132
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000014256
Domain Number - Region: 598-674
Classification Level Classification E-value
Superfamily RNI-like 0.073
Family Rna1p (RanGAP1), N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014256   Gene: ENSLOCG00000011602   Transcript: ENSLOCT00000014285
Sequence length 677
Comment pep:novel chromosome:LepOcu1:LG4:47653504:47655926:1 gene:ENSLOCG00000011602 transcript:ENSLOCT00000014285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCTTGTVSPCSRMSSLTVLKERRATLVDELEDHIDGLLEEMVLKQAFTRDDREDVLCELG
PRKRIRKLLDIIDCKGEEVAGMFLLTYNKLYELKTEAAAEPKNFSEYSKIIQKHKQVLKR
RNESMLYYNSRHGEKILFSEHFVNLLIVNGHHSIENKKHELLAFGQQRIHLQHHSVEQRL
INAAQLFFTNGVRPVKKILITGVAGIGKTVLVQKILCDVGNNQGYFAFDFVIHLTFRDLN
MISKPISLRDLILRKNGHLTKMLDDILSNDDKLLIILDGFDEFKHYKECDIEEYVTEHDQ
PGDVVHIFASLMQGELLPGASVLLTSRPTAISYVPIDCIDRFVVVIGFSVNEINDFFLKY
FQNEELALTMLNMAKANDLMFTLCYIPAFCYIICSILKESKGLTSESPKTMTDIYVQYLV
VLLKSHTQCRTVTACRSSSGNMEEITETVVLLGRLAYVKVLQHETLFYGNDSEVQQLAGS
DFVSTFLDKTSVQEPYCTVDIYSFTHLTVQEFFAALYYVLVEKPDPDVRDSEVCHQQGMS
AGYLDLFNRFLSGLLSQRNQSLLARHIQLRGKSKSEFYVPWLLDEIRTLCETGANILNHL
HCFFEQQNSSLAKNIHPKVLRVNVSDDPLSPMDFGVVKYFLNLVSGNIAELDLTATNITT
ESLRDLQPLLYRCEKLW
Download sequence
Identical sequences W5N0U7
ENSLOCP00000014256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]