SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014402 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014402
Domain Number 1 Region: 34-196
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-45
Family RUN domain 0.0000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014402   Gene: ENSLOCG00000011714   Transcript: ENSLOCT00000014431
Sequence length 442
Comment pep:known_by_projection chromosome:LepOcu1:LG15:1657548:1672196:-1 gene:ENSLOCG00000011714 transcript:ENSLOCT00000014431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCGSAPSWMESSCLQSAMAMGLSSKKASCRSVAVERKNLITVCRFSVKTLLEKYTAEPID
DSSEEFINFAAILEQILSHRFKGPASWFSYDGQRSFWDYIRVACSKVQNNCVSSIENMEN
INSSRAKGRAWVRVALMEKRLSEYIATALRDTRTTRRFYDDGAIMLREESTVLTGMLIGL
SAIDFSFCLKGEVLDGKTPAVIDYTPYLKFTQSYDYMSDDDDRNSVDSSTSDDSIPDHPY
IPLVTDEESWSRKCRKMEQKYKIVYAQKGYLEELVRLRESQLKNLEAENKRLTLRLEEAR
LQSQQEKKELEGIVLELQEQLTGLIPCDSNNLSKEMTIPLVNQWPSLRTFNNQEDVKLFR
RRSFHSVEQLSAEISLDSDSQKTDGKQNGETWCTTGKDYTPSMLGLCGSLASLPSCKSLA
SLKSSECLVTISTEASPALSPS
Download sequence
Identical sequences W5N193
ENSLOCP00000014402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]