SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014611 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014611
Domain Number 1 Region: 328-551
Classification Level Classification E-value
Superfamily Caspase-like 4.49e-40
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 3-120
Classification Level Classification E-value
Superfamily DEATH domain 6.04e-24
Family DEATH domain, DD 0.0043
Further Details:      
 
Domain Number 3 Region: 109-191
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000137
Family I set domains 0.066
Further Details:      
 
Domain Number 4 Region: 208-275
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000286
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014611   Gene: ENSLOCG00000011876   Transcript: ENSLOCT00000014640
Sequence length 821
Comment pep:known_by_projection chromosome:LepOcu1:LG2:49330581:49363981:1 gene:ENSLOCG00000011876 transcript:ENSLOCT00000014640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSSDFYSLNVNTLKEPILKKLSEVLDKTNNKGWRKLGEIVASDRRFKVSGEEMDRCSL
KVLELEGSPSRSLLRLIGDRGCSVKDLVEFLQTMGHAEALQCIKPPGIKIIIQPQSQAVM
SGHTVRLSCHAVGHPNIQYQWFKMKEEVPNGNSPELVFSPVHVQDAGFYICRVNCGGSFE
FSQWAQLEVFDVAATYGSVCHSIDGRLKIVIQPQPQRLLIGDTLDLVCGAVGKPIPQYQW
YKNGLPIKDATKKRCLIPYVTLEHEGKYRCEVFSNEEYLWTQDVHIQIGPRISFKLSEAM
ECSEEDIYAFGQNEFENNRHRSPEKACATDKVALLIGNMSYQNHPKLKAPMVDVYDLTNL
LRQLNFKVVSLLDLTESEMRNAVDEFLLLLDKGVYGLLYYAGHGYENYGNSFMVPVDAPN
PYRSANCLCVQSILKLMQEKETGLNVFLLDMCRKRNIHDDIIPNVEALRVTANIVFGYAT
CQDAEAFELNSSGFTNGVFIKFLKKRLLEDEKITVLLDRVAEDMGKFDPTKGKQALEIRS
SLSEKRALTDPIQPTGCSDETMARNLQWAKAHELPESMCLSFDCGVQIKLGFAAEFSNVL
VIYTSIVKKPEDMSSCQAYVTNFTPELDVDPKEMNKGTPEETGSYLLSKSLPQHCLYTRL
SSLQKLKEQLMFTVCLQGKFTSVEDLVDWSIEVNIGKPLIAKLDLHRTVRRNSCLQTCLM
PHSPSHSPCHSPGAEHYYQHCYPQQYQSSYLGVYDHIHGLGSPCASNSLEFGAHCNLTPY
HQDDMSFPVSPTRVNIPIETTDDINELQTSFIDSLQMNDRY
Download sequence
Identical sequences W5N1V2
ENSLOCP00000014611 XP_015195674.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]