SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014668 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014668
Domain Number 1 Region: 14-244
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.93e-74
Family BAR domain 0.00000000896
Further Details:      
 
Domain Number 2 Region: 286-349
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-23
Family SH3-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014668   Gene: ENSLOCG00000011923   Transcript: ENSLOCT00000014697
Sequence length 352
Comment pep:known_by_projection chromosome:LepOcu1:LG4:50210022:50233900:1 gene:ENSLOCG00000011923 transcript:ENSLOCT00000014697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVVHSSSAQGHVHTQKVSEKVGGAEGTKLDDDFKEMEKKVDVTSRAVLEIMTKTTEYLQP
NNTPSASRAKLSMINTMSKIRGQEKGPGYPQAETLLGEAMQKYGRELGEESNFGLALIDA
GEAIRELGEVKDALDMEVKQNFIDPLQNLHDKDLKEIQHHLKKMEGRRLDFDYKKKRQGK
LQDEEIKQALEKFDESKEIAEQSMFNLLESDIEQVSQLAALVQAQVEYHRQATEILQQLS
SKLENRIREASSKPRREYMPKPRMVMEFTPSENQNGGIAHSGTAKSPAPMDQPCCRALYD
FDPENEGELGFKEGDVITLTNQIDDNWYEGMLHGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences W5N209
ENSLOCP00000014668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]