SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014809 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014809
Domain Number 1 Region: 2269-2565
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.79e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000208
Further Details:      
 
Domain Number 2 Region: 661-769
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-31
Family Second domain of FERM 0.00025
Further Details:      
 
Domain Number 3 Region: 771-877
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-28
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 4 Region: 1358-1455
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-26
Family PDZ domain 0.0000554
Further Details:      
 
Domain Number 5 Region: 1090-1188
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-26
Family PDZ domain 0.0028
Further Details:      
 
Domain Number 6 Region: 2024-2122
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-26
Family PDZ domain 0.018
Further Details:      
 
Domain Number 7 Region: 1802-1889
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-20
Family PDZ domain 0.0095
Further Details:      
 
Domain Number 8 Region: 1493-1597
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-20
Family PDZ domain 0.033
Further Details:      
 
Domain Number 9 Region: 569-661
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-18
Family First domain of FERM 0.011
Further Details:      
 
Domain Number 10 Region: 1893-1984
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000932
Family PDZ domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000014809
Domain Number - Region: 2-148
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000647
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014809   Gene: ENSLOCG00000012036   Transcript: ENSLOCT00000014838
Sequence length 2573
Comment pep:known_by_projection chromosome:LepOcu1:LG2:50307797:50393301:1 gene:ENSLOCG00000012036 transcript:ENSLOCT00000014838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEVWAVLSQSAESLQELFRKADPSALGFIISPWTLLLLPSGN
VSFTDENVTQQDLRAFTAPEVLQGLSPSSLSDIEKMHMYSLGMTLFWGADYKVPQSQPIN
LGEHLNSIMLNMCDDADHTRVSVRTVLDACSAHVRNTSCEPSFSYVRKLVRLVLGSLSQL
DSLLSKSERESLPERSKEIRERLRGKGLPSGRSAAPRVLERYRARAQEQVPLNRGLSRSM
GSLPINDLLRGEEEGGAPYTSLDYNPGHAGGPEQFYQQRVRRTAADRKPPSYRGDSGYPR
KNWSSSLDLAGYDLEALRYGARDGSHKASSLSQRSEGRVGEYRSTDFGGLSSSLEPRKAQ
YVPAHNVNSALLGAYDRIKERQKKLQVLRQAMEVEEPLSTHRRYHSDACSSSSESPSIAS
SDADYRQARRPEDVRRYGSQVGMSEHDVISLASHVSLRNRPYDVASEEGLVSGEVMLRRQ
EEEMQRLQAQMAHRHSLASLYSGELPRTSLLDITRDPLRDMALENSLTQRKLKNFFGPEF
VKMTSEPCLSLDVPTSILNKKGKGDDIRRIINIVLLSGQRLELTCDTKSICKDVLDMVVA
HIGLVEHHLFGLAFFKDNEFFFVDPDAKLSKVAPDGWKDDPKKKRSDVNFTLFFRIKFFV
DDVNMLQHTLTKHQYYLQLRKDILEERLRCDEESALLLATLALQAEFGDYQPEIHGKSYF
RLEHYLPISVLEKVDQRTVKEELPKLHSTYTGASEAETEFEFLKVCQKLTEYGVHFHRVL
PEKKSQTGIMLGVCSKGVLIFELLNAARTPVLRFPWRETKKISFTKKKISLQNTSDGIKH
LFQTDSNKTCQYLLQMCSAQHKFHLQMKARQTNQELQDIENSSLGNMNYLSATPPRSGLG
HAMSTASLAPSSTGLSADLQPVHTDQLKRISHSELSLNKQGPGRWQLVVDPPYPSFGPNP
RAMSRSHHNLSRVPEPPEGPGGTHASQSRSSLNSAHLLANPDGSRLLASHQRASSDTGSI
TASRKHETVSSSKSFAGSTRNPERSLKDSDSSSFEETGQAYVVGISMHSSDMPSTPGSLS
VNDSLRQKLNALPSPEREITMVNLKKDVKYGLGFQIVGGEHSGRKDLGTFISSITPGGPA
DLNGCLKPGDRLISVNDVNLEGISHEAAVEVLQNMPDDVTLVVSQPKERLYKESTSTFQL
KNQSRARSPGQRQKQDDESSSEEHNRAPSCSRPASGGSATVSLSRQNGSMSSQDSRTESA
SLSQTIINGFHKKQVPDGAAPLPSCHPENAVTSDTPAPALPPKTWKGRIPEIVKDQYDSD
RGDSDMDEDTCSSSQEKQMSKGLSPSSSMEKLSGNAQGVNDLKPGDLFDVHLSKKDNSLG
ISVTGGVNTSVRHGGIYVKAIIPKGAAELDGRIHKGDRVLAVNGTSLEGATHKQAVETLR
DTGQVVHLLLEKGQLPAARVHAPVTPQCTPPSVSNVQTDQEVVCEAQGPPKEYSFINDDN
VFEVKLLKNTSGLGFSFSREENLPIEPAGASVVRVKKLFPGQPAAESGKIEVGDVILHVN
QTSLKGLSQHEVISALRGTGLEVTLLLCRPQPGVIPEIDATFLTPMSSPRKELSAPLETN
QNKSALLQKEQSDSSAEEIEEKVGEAEDGLERLQIKSPSRRDSYSDSTDDDEVEKAFSPS
MEQSSQAWDASIYQTPSLSTTQYETACELEDTIQTATYSPQRSPSKPEFHDSNPPSPLLS
EMERHPQAEVPSPTPLDERYFISSPSSHLATPLAHERQTQGVEANTGSLSDKGQDLEEFE
PEAELSVSLLKSEKGSLGFTVTKGNDQSCYIHDIIQDPAKSDGRLKPGDRLIMVNGTDVS
NMSHTEVVNVVRAAPKVVDLVIGRVLDVPKPPIEPRLLPDITFQCQEEKLGLVLGGGSES
PYKVLYVADIIPGSAVSVQTCLRQLDLIHYINGTLTQNLSLMEAKSLLELSKPNIILKAT
RDGRPLAPGTKRLVSLNNLSLKLNGSSGVNGYLHGDESNESELYTSLSPSEERIIHIELD
KPDSGGLGFSVIGGEKGIFVKSITPGSTADKEGTLQVGDRLLQVNEESMAGVSHHRAVTT
IRKTRGVVRLTVSRPPGESPYDFLPLLPAKHKSNKDTGYDNGVESSLYNHADGQISNPLS
KAKTPPSLPPIDYVSKALEVLKREEEETPLSEDTDCDGSSLPEDSPEASRKYGWKEESVD
GPLLESSAHSSQRSTVGAADEDDITWGSEELPIETLKPMVTEDGPIITDEELTSLPLINV
IPGGQYTGSKLNAVIRMMRGLLDQKIPLQEFENLQNLLPLDNCLIGQTKENKKKNRYKNI
VPFDTTRVVLGKDGGYINASFIKMPVKDEGFLYIACQGPLPTTLADFWQMVWEQKSNVIA
MMTQEVEGGKVKCQRYWPDTPRSPEMVDDRLELTLIKDQHLDNFVIRLIEVKDVQTGKVQ
HVTHLNYTGWPDHGTPTQPEQLLTFISYMRHIHQSGPIITHCSAGIGRSGTLICIDVVLG
LISKDVDFDISDVVRTMRLQRQGMVQTEEQYIFCYQVILYVLRCLQAEEKISG
Download sequence
Identical sequences W5N2F0
ENSLOCP00000014809 XP_015195598.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]