SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014870 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014870
Domain Number 1 Region: 43-254
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.92e-80
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000364
Further Details:      
 
Domain Number 2 Region: 547-762
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.25e-56
Family Ankyrin repeat 0.0000196
Further Details:      
 
Domain Number 3 Region: 250-375
Classification Level Classification E-value
Superfamily E set domains 2.22e-46
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000287
Further Details:      
 
Domain Number 4 Region: 815-895
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000647
Family DEATH domain, DD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014870   Gene: ENSLOCG00000012080   Transcript: ENSLOCT00000014899
Sequence length 987
Comment pep:known_by_projection chromosome:LepOcu1:LG4:51289329:51342104:-1 gene:ENSLOCG00000012080 transcript:ENSLOCT00000014899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEDPYLQGGIFDMETFTPLMGMETFNFTAMPPTNSLRVADGPYLQIIEQPKQRGFRFR
YGCEGPSHGGLPGASSEKNRKSYPQVKICNYQGPARVVVQLVTFSKNVNLHAHSLVGKQC
DKGICVADQQPKDTSISFPNLGILHVTKKNVNKTLEERMTEAYRMGYNYGISIHPEIDCL
QSEGRIPRELTEHQKSLITNAATSQAKEMDLSVVRLMFTAFLPDSDGGFTRRLEPVISDP
IYDSKAPNASNLKIVRMDRTAGCVTGGEEVYLLCDKVQKDDIQVRFYEDDETGLAWEAYG
DFSPTDVHRQFAIVFKTPKYRDLNLQKPTSVFVQLKRKSDNETSEPKPFTYHPQVIDKEE
VQRKRQKTLPNFQDFGPPGAGGGMYRGGGPGTGGGPSTGGGQCNFQGYQGYNNFGGGYPF
SHGPGGPGAGMKHASKGPTDDAEDDSDSDTDEDPATAGIVQICGQQASEEIKLPPKVEQS
SSTEDSSPTEDPASAEEEEITADLLFGEKAMQLAQRHAEALFNYAVTGDVKMLLAVLRPL
LAVQDENGDTGLHLGVIHSRTDAVKSLAEVISALPGDDVLSMRNDLYQTPLHLAVITKQA
EAVEALLKAGANMSLTDRHGNTALHLAAKEGEGKILNLLLEHKDAAELIDLPNAAGFHAI
HLAVLANSILCLRQLIEFGANVDACEQSSGRTALHLAVELENVSLAGCLLLEGNAHVDAC
TYNGSTALHIAAGKGSMKLTALLMAAGADPHKENSEPLYDVDDECHLEEEEEDEGFVPGT
TPLDMAMSSEIYDLLNGKQYQPDSKTVVSLPQGDMKHLDEQTKLELCKVLEQPANNWEAL
AQNLGLGILSSAFRLSPSPAKTLLDSYKVSGGTMKELLEGLKAMGNDKAVDIVQKAMSSE
REDTSGPVSTQVTHQQTGALLSQHLQGLENYSQDESSVCDSGVETSFRKLSLLSSESLSS
SQEQAEQAGDHKLPTASPHSYVVKGEV
Download sequence
Identical sequences W5N2L1
ENSLOCP00000014870 XP_015200704.1.81211 XP_015200705.1.81211 XP_015200706.1.81211 XP_015200707.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]