SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000014924 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000014924
Domain Number 1 Region: 782-981
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-46
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 1015-1211
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9e-45
Family BAR domain 0.00076
Further Details:      
 
Domain Number 3 Region: 238-297
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-17
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 4 Region: 1276-1356
Classification Level Classification E-value
Superfamily SH3-domain 1.16e-16
Family SH3-domain 0.0000118
Further Details:      
 
Domain Number 5 Region: 1514-1573
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-16
Family SH3-domain 0.0000911
Further Details:      
 
Domain Number 6 Region: 142-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000761
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 7 Region: 3-62
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000158
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 8 Region: 68-133
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000125
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000014924   Gene: ENSLOCG00000012128   Transcript: ENSLOCT00000014953
Sequence length 1577
Comment pep:known_by_projection chromosome:LepOcu1:LG5:33752296:33791234:-1 gene:ENSLOCG00000012128 transcript:ENSLOCT00000014953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGSVVRAVFEFRPSVSEELPLFTGDVIEVLSVVDEFWLLGNKDGVTGQFPSTFVEPVT
IPNTKRGEKLYVCINDYSSLSAGNLLLQRGDVVVGEDTVDSNWLRGRNCWGSKGVFPLSC
VKELHLSSRSRKLSKRSVSELPSYALGQARALMGLSAQLDEELGFMEGDIIIIVGIPEPG
WFEGELEGRRGIFPEGFVELLGPLQAGEDQGGQDDYDIYEEEDICVEEAPLNTEEFTGVY
GIALYDFRALESGELDFNVGDKIHIINTLEDGWLEGAVNGRRGIFPHRFVKVEDQSTETK
KQQSNSEYGQETENKFVCSPCTIDNHCDWKTEDSGDNSQEKSDQTSSETTWLEALSDVKS
TPASSKLNHEPQGTQTKGNSQGIPINRGDTVIDAKQSTIQNPTPSHRGLTRTNSAPSKPR
LPPRPSLHSLNNRRYSNIPDAVVDQKIADSSSEAPPAPATRTLSLVTKNVLQTSNKNAAY
KDLSCCAQDKKHKNKVRQLSVTDSDLLPGCRIDQQVGCKTAEANGLSSSFTLECLAGSAP
DLDSKLSQQLAEFEKSLPDYKARDSKKISRHFSILDYSSENDIMRGSPTSKSQQEGCSSL
ERRKALRPPPPRPRVLKPQGSPSSPRPSVEGPQPTGEGQPSQSSLAFRPSRPAPLPPQPS
PRRSTPQDSTPFQAGSSSAPQVDGDCVLEAEQDQYSLLLRLQEVERDIEIYTKTMEELGA
MLDEEEDETARAQALENLDFCTYNIESLTVEQQQLREMTLLSAQPASLDSVPAATTSDNA
EQRMTEKRSKVIQELRQTEVDYIKDLQMCVKEIIEPLQRKQVQNVDFDGLFGNINAVIDL
SKRLNKSLQETDSIGRCFLEFKTEMEDVYKVYCQNHDDAISLLEGYEKDENIQKHILECL
ERLRAVYREWGKTNYINVGSFLIKPVQRVMRYPLLLMELLSATPESHHDRERLAEALLAV
KEINVNINEYKRRKDLVVKYRKGDEDTLIDKISKLSMHSIIKKSNRVSSHLKHLTGFSPQ
IKDEAFDEAEKNFRMQERLIKSFIRDISLYLQHIRESASVKVLAAISFCDIYADRNQMDP
ERFQKAHRCISDKQFINFKERTENLVITPLNQLLSMFAGPHKLIQKRFDKLLDYNNCKER
AEKIKDKKMQEELQSARNNYEALNAQLLDELPKFHCCAEELFTSCVRNFAMAQKEFVRLS
LGELKPLLQLSRIGGTEGNLIALFQEAHGQVLQQLQCFSFFPESLPAVRKPFERKSMERQ
SSKKQLQGPPNYVLQTESQRAGLLSKYPPEKLYQAERNFNAAQDLDVSVLEGDIVGVIKQ
QDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSQSDVSIGSHSSTESGYGGSSPVFSRQ
NSNSTLTFNQESASVTFSTLQSQKSGADSVSSRDSQASSQLTPQESCSSRRGNYRETPSP
NRTHYGQRDLSDSASETDSRSSQKNVRTNISYRDAQVDRYIETDPAFSRRNGDCGLPDQR
KLESNHEKECESDGNQIYYAIYSFTARCANELSISAQQRVKILEFHDMNGNQEWWLAEVE
GRRGYVPSNYIRKSEYT
Download sequence
Identical sequences W5N2R5
ENSLOCP00000014924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]