SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015017 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015017
Domain Number 1 Region: 28-231
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.03e-40
Family DBL homology domain (DH-domain) 0.00082
Further Details:      
 
Domain Number 2 Region: 263-454
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.15e-24
Family BAR domain 0.023
Further Details:      
 
Domain Number 3 Region: 603-676
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-17
Family SH3-domain 0.00077
Further Details:      
 
Domain Number 4 Region: 509-578
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000184
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015017   Gene: ENSLOCG00000012204   Transcript: ENSLOCT00000015046
Sequence length 690
Comment pep:known_by_projection chromosome:LepOcu1:LG6:37996993:38010465:-1 gene:ENSLOCG00000012204 transcript:ENSLOCT00000015046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTPGALTPPPKSGEEEEEPAEPESIVDTMKQKQLLAVEELLSTERSYLRMLQLCAVVI
RGHLKQLQPPLGNVEGVFSNVDDVIEVSSCLLSLLEQKEPTDPEFLSALCSAFLSLREDM
EMVYREYCASYNTIVAMETSFRQREGLWQAVVNTIKTSAPDVNATSLTFFLVMPVQRIAR
YPLLLQTMLKHTDAQHPAAPALRQAAEAAVALNCRINEYKRVREVADKYKRTENLTIRDK
ISRLSGHSIAKKTARMSQMIKHETGIKPKIRDEEFDILEGYFCVLEKGIIELHENVGAYL
RHLQNYLSFRPEERELELDHVRAARCYKEVAAPLRQWMYPAFEGRLQALVYRPLCALREL
LAGPRNLIRKRLHKLLDYELLEEKQSLSYEDEAVANTYRTLNALLLAELPKFTATTLQLL
WGVLGAFSCIHRDLAEDVAQLAGGYLPQLPHSQLEPSAFWQWAEESVLQGAESMERLCRS
VAEELNDPVVQPLSPSFQKRLKVLTDKHGVGRIYQLTGNVGGTRELDLTLQRGDLVAVLG
EMDTRGDRRRWLVDAAGRRGYVPASKLTPYHQATQASSSSPSPASLPQHLAPAMGGAEFR
RHSFSPATQPIVIRTPPCLQVCAGYDFAARGHHEVSLQAGEPVRVLEPHDKRGNPEWSLV
EVRGQRGYVPSNYLTVQLPGPAIQPAPPAT
Download sequence
Identical sequences W5N308
ENSLOCP00000015017 XP_015205525.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]