SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015048 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015048
Domain Number 1 Region: 501-574
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000126
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015048   Gene: ENSLOCG00000012232   Transcript: ENSLOCT00000015078
Sequence length 586
Comment pep:known_by_projection chromosome:LepOcu1:LG15:3582514:3591153:1 gene:ENSLOCG00000012232 transcript:ENSLOCT00000015078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMSTEELSTSDSEPAFAGGERWAPVGAVASPEDEEPADGKSDAPGPRCRGASSAGAADM
ATRLRKLQEEQDLLNSSLLALTSHFAQVQFRLKQIVHAQSEEKEGLLQELEEFAFKGCPH
VLGCRAQDAQVLENSIHMLYFQEELSEREKRERLEAQREKQRELIVQLKTQLDDLERFAY
QEGSYDSLPQSVVMERQRVVIIDELIKKLDVNLNEDIGRLSPEELRQRVDSAIAQIVNPA
RVKEQLVEQLKTQIRDLEMFISFIQDEVGNPLLPGNGQSQPTGSANPNMRGPAGNRKVDP
EQARKMRETGLHLMRRALAVLQIFAVSQFGCATGQIPRGLWRQDEAAQDYGPPLRRLEAA
VDRVRHQALRRQPVEEHVINYTSGPAWGARDELTAAVRKELAMALRDLLAHGLYAPSQGM
SLVLAPIACLLPSFSSSPQTLHPWELFVKYYHAKNGPAFAESPARKLSQSFSLPVGGGGA
ATVTPKQSLLWAVHQVLREHDPFKRGADSEFKALVCLALNEQRLVSWLNLICKAGSLVQS
HYQPWSYMAQTGFESALHILSRLSHLKFHLPVDLAVRQLKNIKDAF
Download sequence
Identical sequences W5N339
ENSLOCP00000015048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]