SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015302 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015302
Domain Number 1 Region: 831-1091
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-40
Family YWTD domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 1151-1382
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-23
Family YWTD domain 0.0006
Further Details:      
 
Domain Number 3 Region: 779-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000419
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 4 Region: 583-623
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 5 Region: 247-283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 71-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 156-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 509-546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 669-705
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000128
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 10 Region: 1526-1569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family EGF-type module 0.026
Further Details:      
 
Domain Number 11 Region: 337-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 12 Region: 1453-1491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000654
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 13 Region: 708-743
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000812
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 14 Region: 379-417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 15 Region: 1-28
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000103
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 16 Region: 466-506
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 17 Region: 32-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 18 Region: 753-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000133
Family EGF-type module 0.024
Further Details:      
 
Domain Number 19 Region: 553-584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 20 Region: 631-663
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000772
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 21 Region: 1092-1131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family EGF-type module 0.023
Further Details:      
 
Domain Number 22 Region: 116-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000995
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 23 Region: 207-244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000185
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000015302
Domain Number - Region: 1411-1444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 291-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00034
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number - Region: 420-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00196
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015302   Gene: ENSLOCG00000012428   Transcript: ENSLOCT00000015331
Sequence length 1650
Comment pep:known_by_projection chromosome:LepOcu1:LG2:53092550:53127496:1 gene:ENSLOCG00000012428 transcript:ENSLOCT00000015331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDDGACITKSWKCDGQGDCLDGSDELDCGSGCKDGEFHCRDGFGCVDISAVCDGKPQCDD
RSDELNCVESRGCLSGEWECVNKICIPQKLRCNGVNDCIDNSDENGCDGHRDALLHCEKR
TFVPCSDGSNCVHYDHLCDGEKDCADGSDENNCPRCADPDHFSCPNSTCIEKKLVCDGMN
QCEDGSDEKNCPPKSNDCAFRCDGDAKCFVHKVACWDQSDCVRYDHLCDKEKDCADGSDE
EDCPRNCIEADNFQCNNGMCIERILICNGVLDCTDGSDEDRCQELVTECTNPCDSGSSCF
SPSSRCDGKKDCRDGTDENDCRDPNPDPSHKTDMTKTVSCPSAFVACRKGVNCIPIEQLC
NGNKDCPDGSDEESCDTKCKEPGYYQCKDGQKCIEKALVCDGEPHCLDSSDESGCPVTTP
NCKLRCDGGTKCVSDKQYCDGNADCIDGADEDCRFQDANGSVTETMAPLVCNLGFKLCRD
GKECILYSHWCDGEADCKDSSDEDSCADKCPTGFFQCAHGKKCIEEKLVCDGTSECQDGS
DERNCWKPTESCAFRCDNNSRCFPESFRCDGEYDCVDKMDEANCAEQECSSSEFRCGSGQ
CLSLSLRCDGDADCRDHSDEEDCSKPPHCPTKKRCPESHECLLEEWICDGDKDCKDGTDE
KDCRPSEVKCSEFQWSCASKTQCIPNFWRCDGEKDCNDDSDEAGCGLVKCPDYQFQCSNL
ECLNTSLVCNGISNCPDGSDEGGDCNTHPCSSSRKCSHACYVTPTGPKCSCEVGFKLAAD
GVSCEDLDECMESPGVCDHKCINMRGSYSCQCHSGYLLERDGHSCKIIGEPFLLASVQYE
LLIYSLHGSSMEVLFSTGKRLVFSVDYDWQEQLVFWVSLDAESIKWISMDQKDKGTLVKG
IKSDCIAVDWLGRNLYWTDGVAGQILAISLNTTSTNIRNNTVVLNEDLEQPHSLVLHPQE
GMMYWTEIGEPQIEKAGMDGSDRKVIIAKGLSWPISLTLDLLDLRIFWTDEKLKCIGSAN
MDGTDIKLLQLTESPNPFSVVVFNNMIYWSDTKRRTIQKANKITGKNRSVFLKRLGQPFG
LKIIHESLQVTSANPCKSLDCSHICLLGPRQRAVCRCPVGYLLTEDGVTCDIPGDTTFLF
LLSASTLSQVYLKNMHTLTDLNTWPEHKALPIAGVNEATAMDYVLKDQTVYLADDEGGFV
GRFKLKDSELVFRRKVLELQGETVMALAVDWLSHNLYWSSSQRALLCVTSSSNNYTAIIF
EDGVEGIDSIALYPPSGAICFADMGKEGRRSQAKIECAYMNGQNRRVLWQKTMMPTCLTF
STSGTELFWADPGAGIIGSIGIDGFKYKAYKTGGGILTSFAQTDNIFLWTTVNDTAKLWF
SDGLQPRQLWFDVKTNVVSLKVYSKFSQKGTNLCADQNGGCSHICLPFPQGRTCKCAQGY
HSINSTGCVKDLNCPPHTKACRDGRKCLHSSKFCDRWMDCLDNSDEESCAKVIKKPPLPP
SSGASGMPPSTTQAVNNKILVRKLDVQTCRDELCHNQGKCVVVNDQPTCECLLGFTGQFC
QDKVIKSIQVPLTLGMIGFLIGMVLIVVIFVLLRKRRQANRRPQTSATETALTNLENIAD
TTSVHTFTNESYDPEEENTVFRTLKLPIMT
Download sequence
Identical sequences W5N3U3
ENSLOCP00000015302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]