SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015304 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015304
Domain Number 1 Region: 691-731
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 2 Region: 349-382
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 77-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 216-252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 617-654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 776-813
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 7 Region: 454-493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 8 Region: 813-850
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 9 Region: 34-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 497-535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 173-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 2-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 13 Region: 576-614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 14 Region: 661-692
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 15 Region: 305-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 16 Region: 117-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 17 Region: 739-771
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 18 Region: 259-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000484
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 19 Region: 391-422
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000015304
Domain Number - Region: 538-571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000471
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015304   Gene: ENSLOCG00000012428   Transcript: ENSLOCT00000015333
Sequence length 855
Comment pep:known_by_projection chromosome:LepOcu1:LG2:53092553:53114394:1 gene:ENSLOCG00000012428 transcript:ENSLOCT00000015333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDGACITKSWKCDGQGDCLDGSDELDCGFLTTFSLGWCKDGEFHCRDGFGCVDISAVCDG
KPQCDDRSDELNCVESRGCLSGEWECVNKICIPQKLRCNGVNDCIDNSDENGCGSETCGE
MDMRCSSGRCVSADKVCDGEAQCSDRRDEPATCGVVLSSFWGKVCNQKEPASAPARVCPR
TFVPCSDGSNCVHYDHLCDGEKDCADGSDENNCPRCADPDHFSCPNSTCIEKKLVCDGMN
QCEDGSDEKNCPPKSNDCAFRCDGDAKCFVHKVQCDGKKDCDDGSDEEQCSVSPLLRRPT
GTPVRTCPRLTVACWDQSDCVRYDHLCDKEKDCADGSDEEDCPRNCIEPADNFQCNNGMC
IERILICNGVLDCTDGSDEDRCQELVTECTNPCDSGSSCFSPSSRCDGKKDCRDGTDEND
CRKSLVLKDVPCFNELHLIDLSCPTSNSGAALMSSVSCPSAFVACRKGVNCIPIEQLCNG
NKDCPDGSDEESCDTKCKEPGYYQCKDGQKCIEKALVCDGEPHCLDSSDESGCPVTTPNC
KLRCDGGTKCVSDKQYCDGNADCIDGADEDCQTMAPLVCNLGFKLCRDGKECILYSHWCD
GEADCKDSSDEDSCADKCPTGFFQCAHGKKCIEEKLVCDGTSECQDGSDERNCWKPTESC
AFRCDNNSRCFPESFRCDGEYDCVDKMDEANCAEQECSSSEFRCGSGQCLSLSLRCDGDA
DCRDHSDEEDCSKPPHCPTKKRCPESHECLLEEWICDGDKDCKDGTDEKDCRPSEVKCSE
FQWSCASKTQCIPNFWRCDGEKDCNDDSDEAGCGLVKCPDYQFQCSNLECLNTSLVCNGI
SNCPDGSDEGGDCNT
Download sequence
Identical sequences W5N3U5
ENSLOCP00000015304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]