SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015405 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015405
Domain Number 1 Region: 4133-4179
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000457
Family RING finger domain, C3HC4 0.0039
Further Details:      
 
Domain Number 2 Region: 2578-2707,2745-2835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000162
Family Extended AAA-ATPase domain 0.056
Further Details:      
 
Domain Number 3 Region: 2938-3153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000164
Family Extended AAA-ATPase domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000015405
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.068
Family NOB1 zinc finger-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015405   Gene: ENSLOCG00000012503   Transcript: ENSLOCT00000015434
Sequence length 5344
Comment pep:known_by_projection chromosome:LepOcu1:LG10:35605444:35652581:-1 gene:ENSLOCG00000012503 transcript:ENSLOCT00000015434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSDCGHVAAEQNAKFCSECGKKLSQSQAPSQGKTPPVLEDQLERGDEQRTDSEPSSVD
STTMQHNEQKRHSEDEDCPKKKRKKKKDKRKKSKQSSSLESEEMATELSDISLADKPTSA
VEEEAVPSDSEDESGAMDDTAALVQEAGRSTQPVNTNTASQEPCPGSPAQVQKTRKMSDC
APFEKATRETVKTNIPPRVPAGSTETSAEGRDSSFIPSQEQTGSVVPSTEGSSSSRCSHH
STPEASASSPGAVQKPAEPERQKNPELEQHTESSNSSLIPPQAQTGSTEQSREGSNSSPT
PHRAQTGSAQRSTEGSSSSHCSRNATREASASSPGAEPKPAEPARQQDLEQKPQAAGKLK
QQQATAMDNKSVKNRKDTAQFQRGNLDQNPNVAGEPRETRNTSKIQEQEEKHMSGGDNKQ
KSELSHNKQEKNTDKDKKYKNENHKAEQMKVQEASCPEGNQDKPIEAKLASESEDKSQQE
SDTNGFQEVTGKKSKKRNKNKNNETNEQTQSRVFEQQHIQPGDRLTIYFHAVLSKDFNFD
PSKHKIYVRGGSVFGNWSCNAVELHVIKELEKHGFLVGGHLDVPKSSVVKKPIPYKYYLC
CNGKDDYEHIYKWDVPEGTIVNRCLCIAEKDVSHHNEWHQFDDIICKKPSENFKRYFTVS
YWTDQRKRDVRKGRFLAGNFMLYSIFDLLTEWNETNLNNFFSQLKMFYMTYQDPVIDENG
PKKWFSLNFKENEVQSLLKDALIGLIGPHLEKETETRMVHIENPIKAAALVLILWEKYNI
PLKPEERHVLCQLLCFPKLPKEQQISFCWDLKESFKSMKALRDILTNFCNVVMNEKQFRS
ILLIPLLHFLSDMCKPFEPIEWKRGITAEDVWGGLEGLPFVDFRNKIYQHEKDLLALMVS
NKHLVDIDRMLTRSWLCFLKIENFLEYESVFNLDLLDLLQGLLYKLVQHEHRLQEPLFKI
LSHILDKLSDKESCVYEINYLMACLKAALKLQQCVCSSIKGLWNYELPIKSVEIIIKLSD
LEEHLLPEENEGTKENLKELNINDLLSDSLQTMRQWIKKTFINRLLKSSTLSSVYVYFHN
AHEIKMWNDVISLKSRKEMFLSNWISAHMKDFEGKLKQETPLSQIEIYCSKNDEMKQLNP
LLAQCFENCALEAVHSICQENKAGVLFESLQRHKIGKFSSLVSKIIEKSWPISKQGKLLD
GYDVMEHLLTWPASNNIFQLQDANLIEELTDEAKSLITVSDSVFFDITTQLLSGNIQIKY
LKIILRKREEFLTLLKIKEPSINDKNCNEHSMRSVLQWREAELDALLSERTWVDSLLKMC
SKIHDFVNVDVEELEERHLYDIDLEKLCEVVVVLQLDQAAANDAGTVIYFQLDEEMRQMA
KTIHTFKDSYIFQMCWENQAKTLSVTDLETEAFEPDPDLIITMDNINEEIFTPCFDKYQH
IYSSMQTGTLTLGDVDEIFRDYKDRYDELGKDFLIMSKLNLSHDRKWIRIKIQQIKQYHQ
LHLAVESAKVIMEVKKTLNLNGDFHVLQTLLDVMHADFKGESLDCIDAELIKAKAILVDI
TEARRKCLQELGQRVVFVTWVKEALEDINELKVFVDLASISAGENDLDVDRVACFHDAVL
GYSSMLYDLKPDSGFNEFKEVLKKLWKALENDHNLPKKLCDTARHLEWLKTVKDSHGSVE
LSSLSLASAINQKGIYIISSQYQKKVNLDTALQLRITEEHEDGQDVRCYSLEDLKELQNK
LMLMSGKGEQGQCEVERFAEVFSSVQRLAMSFIDLHAAGNMLFRDWEAKINCSEHSEACI
IMDFNLENTIGEIMFSGAVVEQLPDLCKKTEKYLRFWKEFMDRKRSQHYFLNYYTAEQIV
YLCKKLTPDKQDSLEDQVLMLLSFITPNCTVSDIRECWHKWQYDDLKDISQPDEEMDFQT
FVDETNMEVDIFLGSKEGTYTLEDLPALLHSAKGAEKLDLVWNFYMRDMKHFLPNCIDIG
TLGKLLEILATKEDKEKKTVQRNLPNGLQQGCPNLIICPHDEILTSCICIYMSSMDEDLP
TYDEVLLCSASTPYEQVEIFLRRCLTEGYKGKKIYTMLYADELSYDVSYRFEQLFQRLKM
ECRGDYRLVIICNSDREHFYIPSAFSQHKVHMIPHERLDKVQAYLSGHYTVSTEVPTAAS
VFKDRMFVGIVSSKRAGVGKSLYIRRLQEKLKQSTRDKSALLKCIRLIEPRVNENAILQS
LLNTPKKKNQLTIFHFDITSSVQKGLYEFLFTLLVLHYLMDTEGHMWKCSNKHLYVIEIL
ETSGGLPRKSSRNVSKAQYVFLDIFPKIFCRPPKEVLELEMRIQDDRMTDVSDPLMDDQE
FRSEAYQRPYQYLTRFHNKMNLDSFTYRGVEGTHVECLQMFFVYCGILDPSWAELRNFAW
FLNLQLKDSETSVFCDVNFTGDTLQGFKNFVVDFMIMMAKDFATPSLSISDQSPGRQQVD
LAGVNEEDLAPFRIRKKWESEPHPYIFFNDDHISMTFIGFHLRLNDQNMVDAIDPSTQKI
IKKNIMTKQLYDGLRLQRVPFNIDFDKLPRGEKIERLCNVLGIQWPLDPDETYELTTDNI
LKMLAIHMRFRCGIPVIIMGETGCGKTRLIKFLCELRRSGAPSQNMKLVKVHGGTSAEMI
YTKVREAMSLALINKEEFLFDSVLFFDEANTTEAVSSIKEILCDNTVEGEPLCQNTGLQI
IAACNPYRKHTDLMIQRLESAGLGYRVRAEETEDKLGSIPLRQLVYRVQALPPSMIPLVW
DFGQLNDQTERMYIQQIVQRVIQTISVHANYIKMITEVLSCSQIYMRQMKDECSFVSLRD
VERCMQVFVWFYRNHTMLLEELHAFETKDHNQHNDHNTRDPVVWSLIMAVGVCYHACLEK
KEKYRKKICKHLPETNTHVKVMQEISLMQDLLLSGVPLGKTIAKNNALKENVFMMVICIE
LRIPLFLVGKPGSSKSLAKTLVADAMQGHAAHSELYKKLKQIHLVSFQCSPHSTPEGIIN
TFKQCARFQEGKNLTEYISVVVLDEIGLAEDSPKMPLKTLHPLLEEGCIDDEPLPHKKVG
FIGISNWALDPAKMNRGIFVSRGDPDEKELIESAKGICSSEPMILKKVQGFFQVFARAYL
NICKEQGKEFFGLRDYYSLIKMVFAMTKASDQEPSAKQIVEAVLRNFSGRDDVDTVAAFT
SKLKENPEISTMELVRQNIEAVGQDDECRYLLVLTKNYAALQILQQTFFSDQHQPEIIFG
SSFPKDQEYTQICRNINRVKICMETGRTIVLLNLQNLYESLYDALNQYYVCLGGQKYVDL
GLGTHRVKCRVHRDFRLIVIEEKEVVYKQFPIPLINRLEKHYLDINTVLKSDQKQIVKEL
EKWVKDFTALNLQHSLNPQAHNYVPSDVFIGYHSDTCASVVLQVTEKLKGNLGASEEQRK
VLQETKLVLLNCATPDSVVRLSSTCLSNVETEELANAYFETQKHDSLASFILSHVLQEER
SQTSFTEVTTFSRLLTASDVDRLLQDVISFQNVELLSLQQFDTEHSFLKKIRSFLDTRFG
NKILIIQTDFVEDSQSSNLIASAKYSAINEINKSRDEMTEILVYFITKLPRMEGGTSYVG
FHGGPWRSVHIDDLRKSKDIVSDITTLKSLTISQLFEEREKPNKPEAMETDDTKMESPTL
EENADLEDILDTTALVRSCVQSAVGMLRDQLEGGSRSTRRLEILLTLLAENEETKASFLK
TMKRRLHALLVTHDENTPSPKNWVFKEASNIDALQEGGTFRHTLWKRVQAVVIPFLAQVI
SMIDRDCNLDLLVDSNSVESVKKLWLEIFGNLKLLYIPYTKVDRNSESKTILVQNYMKLD
HNLCSTMPFSWRIKDHLDELWVHVLQREGHTHNQLEEFFKKTPLGRYIADADEEMQKEFF
HRYLQDFISMTMKVTSPDELMLLRSALLSCVNELKIRSNANKEKVTSLPWVHTAYHEFKT
RLQNLSRMITIEPQVAQFLQRKMQSREGAEMVLDVYAAVACVELLEPHNLDTDGLCLEWL
RRVKRLQVPIELVCAEECVQNYGSRSQELVKFVRSGWNRIFSSSLFVEHVLLGIESVQKD
LKVLVVTHARKLWKSLEQNSDFKMEQPFLAVIEVLKSCKDEASERLFRFGRQLCAVCLGE
PTDPLCLPCEHIYCLVCIKQWLLPGQMYCPLCMVEVPQNFELKVSEDIRHLVQLYAQFRK
RCNAFFIDMVSTLCFKDNSPPSDSIILHLLSFLMVDTNAVPNIKKGRRVYTKALSPFNDS
VDKNPVVRSVVLKFLLKYSFDDVKRYLQEHLSSVEQSNILEKTDKTKLCALYINCLEDSM
YEKTQSQTELETVASLEQETRFLQCCVQNTEAGPEKISIEYLQSIARIRLCLDTAACLLV
KDLSGLATGTQQDPEVYRRISAFLNHVMEFCRRSKNDWYRIYMIRKICNQKGMEFVQTLL
TKPEFHWLFPEEIVQQNEHTGQIDQYLVCGINYQAFRDAVGRAMIECKTEGIEEANKNCR
SPLQKKTARLLLAIFREVTTLYRAANQNVHPKPEQCQAIEDFIKGSQIFGSPELKNLATS
LVYNRLGDLSVRPDCTSSEHAITELAIHLTTVLLCGQDGILTPLKQLALAPVNMQNAFLP
TMPEDMLVVAVQVLGNLQWYSCPNGHPCTIGECGQPMERSHCVDCGAVIGGDNHRAVQGF
QQTNFTGDRTQTGHVLGDARRRDNPDMLDTKSMSPAPFILIRLLTHLAMLLGASRDPRSI
SQMIKPAVQNPHVFLVNHLVKDMEQLSRTLGKGTDDSVNIVHLLLSRLLEPHQAQQWPVP
YDNILSTKEARNGWETVIATEIITPQLKSLERRLKEVNDLIRKDSRVSSSPIMKVIYGDP
HIFLKALPLDKIFHCSAIWSCRERVSVQNLAHIVEQHDGKDTLPVLWKFLQKEAELKLVK
FLPDILALQRNLVRKFQNVTEHMHKTIGDFIQSQKAESLKAWYETRICTFLTVWNQLRAS
LVTNGEIKISEDYCKEDLNLDSEFQVLLPQRHGLGLCSTALVSYLIALHNELVYTVEKHT
GEENSYSVSPADLTDLHVIKYEVEKDLIPLILSNCQYSMEQGQETVLEYDLHKTQQQILN
HFLQGKPLITLTGIPTLVNRQDRNYENIFKDVKGKLMQDSLPALMLNALSGELQSYTDVC
EALSVVEVTLGFLAMTGGEAEMQLVKYVQDILQMGDQTAPHILKALSRCTLKHSIALWQL
LTSLKSECMLRLKRDPFLEISKVYKKPLLDGDKKLLTGFLTKGCVDTFVLEMHEFLLLNL
KKVNAPEEFRPDWSLKHTLVSYIERKDLDVPPDMEEILPEETCLSQFVETWKFAVAFRQE
RHQR
Download sequence
Identical sequences W5N446
XP_015211840.1.81211 XP_015211841.1.81211 ENSLOCP00000015405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]