SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015416 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015416
Domain Number 1 Region: 111-278
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-39
Family RUN domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 606-671
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.15e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015416   Gene: ENSLOCG00000012518   Transcript: ENSLOCT00000015445
Sequence length 675
Comment pep:known_by_projection chromosome:LepOcu1:LG6:39728417:39740527:-1 gene:ENSLOCG00000012518 transcript:ENSLOCT00000015445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHVLKMEADARCVDTGAGDQDKEDFEVLEGVPESAVGSPQEEQKEKPPPDGGWSAPILSL
ARRATESLSSTVSHSSALRGAASAAGVLSSKPHPASNDGHTPKPGRDALAVERSNLLNMM
KLSVKVLIQSALSLGRSLDSDYPPLQQFFVVLEHCLKHGLRGKSKYMKENERFGTPIKLI
EEVRAASVQVPTPARTGAGSSSERTFVGRARAWLCLALMQKKMADYLKALLDHKDLLSEF
YEPGALLLEEEGSVIVGMLVGLNVIDANLCLKGEDLDSQATGLFLTGPAQTPSLSPWSPL
PVGTLTSRNACSWRTWTGCGKEAGVVPAGTPGRSASRRPRERRRSADPAGVAVRSGLRKV
ARSERARIPPSGRAAEHCSASQGLEACPNLLVKQLLLGLRFSVAQSGSPPGIVWDKNVTA
VIKHLMILYRTEVETVSWSLVSFGRLQEIKGAAGLPRARHAAGSQLCLLGSLACRRLEGN
YGMGSHIVSLSWRLERQLCLLSPADCTLSPLSLGLESELKSEKEQRQGLQRELQREKDTS
TQLRTQLQQLDGLQKELLEMRREKQQLQKTCEEQEQALQEMGLHLSQSKLKMEDFKEVNK
ALKGQAWLKDDEATQCKQCQKEFSISRRKHHCRNCGDIYCSSCSSNELALPSYPRPVRVC
DTCHTLLLQRCSTGS
Download sequence
Identical sequences W5N457
ENSLOCP00000015416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]