SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015418 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015418
Domain Number 1 Region: 4001-4047
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000437
Family RING finger domain, C3HC4 0.0039
Further Details:      
 
Domain Number 2 Region: 2798-3013
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000015
Family Extended AAA-ATPase domain 0.039
Further Details:      
 
Domain Number 3 Region: 2438-2567,2605-2695
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000162
Family Extended AAA-ATPase domain 0.056
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000015418
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0589
Family NOB1 zinc finger-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015418   Gene: ENSLOCG00000012503   Transcript: ENSLOCT00000015447
Sequence length 5214
Comment pep:known_by_projection chromosome:LepOcu1:LG10:35605444:35652581:-1 gene:ENSLOCG00000012503 transcript:ENSLOCT00000015447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSDCGHVAAEQNAKFCSECGKKLSQSQAPSQESCKTPPVLEDQLERGDEQRTDSEPSS
VDSTTMQHNEQKRHSEDEDCPKKKRKKKKDKRKKSKQSSSLESEEMATELSDISLADKPT
SAVEEEAVPSDSEDESGAMDDTAALVQEAGRSTQPVNTNTASQEPCPGSPAQVQKTRKIE
GSNSSPTPHRAQTGSAQRSTEGSSSSHCSRNATREASASSPGAEPKPAEPARQQDLEQKP
QAAGKLKQQQATAMDNKSVKNRKDTAQFQRGNLDQNPNVAGEPRETRNTSKIQEQEEKHM
SGGDNKQLFSPLHQQKRNQDKPIEAKLASESEDKSQQESDTNGFQEVTGKKSKKRNKNKN
NETNEQTQSSLNRVFEQQHIQPGDRLTIYFHAVLSKDFNFDPSKHKIYVRGGSVFGNWSC
NAVELHVIKELEKHGFLVGGHLDVPKSSVVKKPIPYKYYLCCNGKDDYEHIYKWDVPEGT
IVNRCLCIAEKDVSHHNEWHQFDDIICKKPSENFKRYFTVSYWTDQRKRDVRKGRFLAGN
FMLYSIFDLLTEWNETNLNNFFSQLKMFYMTYQDPVIDENGPKKWFSLNFKENEVQSLLK
DALIGLIGPHLEKETETRMVHIENPIKAAALVLILWEKYNIPLKPEERHVLCQLLCFPKL
PKEQQISFCWDLKESFKSMKALRDILTNFCNVVMNEKQFRSILLIPLLHFLSDMCKPFEP
IEWKRGITAEDVWGGLEGLPFVDFRNKIYQHEKDLLALMVSNKHLVDIDRMLTRSWLCFL
KIENFLEYESVFNLDLLDLLQGLLYKLVQHEHRLQEPLFKILSHILDKLSDKESCVYEIN
YLMACLKAALKLQQCVCSSIKGLWNYELPIKSVEIIIKLSDLEEHLLPEENEGTKENLKE
LNINDLLSDSLQTMRQWIKKTFINRLLKSSTLSILSKYKNIFQMWNDVISLKSRKEMFLS
NWISAHMKDFEGKLKQETPLSQIEIYCSKNDEMKQLNPLLAQCFENCALEAVHSICQENK
AGVLFESLQRHKIGKFSSLVSKIIEKSWPISKQGKLLDGYDVMEHLLTWPASNNIFQLQG
ADANLIEELTDEAKSLITVSDSVFFDITTQLLSGNIQIKYLKIILRKREEFLTLLKIKEP
SINDKNCNEHSMRSVLQWREAELDALLSERTWVDSLLKMCSKIHDFVNVDVEELEERHLY
DIDLEKLCEVVVVLQLDQAAANDAGTVIYFQLDEEMRQMAKTIHTFKDSYIFQMCWENQA
KTLSVTDLETEAFEPDPDLIITMDNINEEIFTPCFDKYQHIYSSMQTGTLTLGDVDEIFR
DYKDRYDELGKDFLIMSKLNLSHDRKWIRIKIQQIKQYHQLHLAVESAKVIMEVKKTLNL
NGDFHVLQTLLDVMHADFKGESLDCIDAELIKAKAILVDITEARRKCLQELGQRVVFVTW
VKEALEDINELKVFVDLASISAGENDLDVDRVACFHDAVLGYSSMLYDLKPDSGFNEFKE
VLKKLWKALENDHNLPKKLCDTARHLEWLKTVKDSHGSVELSSLSLASAINQKGIYIISS
QYQKKVNLDTALQLRITEEHEDGQDVRCYSLEDLKELQNKLMLMSGKGEQGQCEVERFAE
VFSSVQRLAMSFIDLHAAGNMLFRDWEAKINCSEHSEACIIMDFNLENTIGEIMFSGAVV
EQLPDLCKKTEKYLRFWKEFMDRKRSQHYFLNYYTAEQIVYLCKKLTPDKQDSLEDQVLM
LLSFITPNCTVSDIRECWHKWQYDDLKDISQPDEEMDFQTFVDETNMEVDIFLGSKEGTY
TLEDLPALLHSAKGAEKLDLVWNFYMRDMKHFLPNCIDIGTLGKLLEILATKEDKEKKTV
QRNLPNGLQQGCPNLIICPHDEILTSCICIYMSSMDEDLPTYDEVLLCSASTPYEQVEIF
LRRCLTEGYKGKKIYTMLYADELSYDVSYRFEQLFQRLKMECRGDYRLVIICNSDREHFY
IPSAFSQHKVHMIPHERLDKVQAYLSGHYTVSTEVPTAASVFKDRMFVGIVSSKRAGVGK
SLYIRRLQEKLKQSTRDKSALLKCIRLIEPRVNENAILQSLLNTPKKKNQLTIFHFDITS
SVQKGLYEFLFTLLVLHYLMDTEGHMWKCSNKHLYVIEILETSGGLPRKSSRNVSKAQYV
FLDIFPKIFCRPPKEVLELEMRIQDDRMTDVSDPLMDDQEFRSEAYQRPYQYLTRFHNKM
NLDSFTYRGVEGTHVECLQMFFVYCGILDPSWAELRNFAWFLNLQLKDSETSVFCDVNFT
GDTLQGFKNFVVDFMIMMAKDFATPSLSISDQSPGRQQVDLAGVNEEDLAPFRIRKKWES
EPHPYIFFNDDHISMTFIGFHLRLNDQNMVDAIDPSTQKIIKKNIMTKQLYDGLRLQRVP
FNIDFDKLPRGEKIERLCNVLGIQWPLDPDETYELTTDNILKMLAIHMRFRCGIPVIIMG
ETGCGKTRLIKFLCELRRSGAPSQNMKLVKVHGGTSAEMIYTKVREAMSLALINKEEFLF
DSVLFFDEANTTEAVSSIKEILCDNTVEGEPLCQNTGLQIIAACNPYRKHTDLMIQRLES
AGLGYRVRAEETEDKLGSIPLRQLVYRVQALPPSMIPLVWDFGQLNDQTERMYIQQIVQR
VIQTISVHANYIKMITEVLSCSQIYMRQMKDECSFVSLRDVERCMQVFVWFYRNHTMLLE
ELHAFETKDHNQHNDHNTRDPVVWSLIMAVGVCYHACLEKKEKYRKKICKHLPETNTHVK
VMQEISLMQDLLLSGVPLGKTIAKNNALKENVFMMVICIELRIPLFLVGKPGSSKSLAKT
LVADAMQGHAAHSELYKKLKQIHLVSFQCSPHSTPEGIINTFKQCARFQEGKNLTEYISV
VVLDEIGLAEDSPKMPLKTLHPLLEEGCIDDEPLPHKKVGFIGISNWALDPAKMNRGIFV
SRGDPDEKELIESAKGICSSEPMILKKVQGFFQVFARAYLNICKEQGKEFFGLRDYYSLI
KMVFAMTKASDQEPSAKQIVEAVLRNFSGRDDVDTVAAFTSKLKENPEISTMELVRQNIE
AVGQDDECRYLLVLTKNYAALQILQQTFFSDQHQPEIIFGSSFPKDQEYTQICRNINRVK
ICMETGRTIVLLNLQNLYESLYDALNQYYVCLGGQKYVDLGLGTHRVKCRVHRDFRLIVI
EEKEVVYKQFPIPLINRLEKHYLDINTVLKSDQKQIVKELEKWVKDFTALNLQHSLNPQA
HNYVPSDVFIGYHSDTCASVVLQVTEKLKGNLGASEEQRKVLQETKLVLLNCATPDSVVR
LSSTCLSNVETEELANAYFETQKHDSLASFILSHVLQEERSQTSFTEVTTFSRLLTASDV
DRLLQDVISFQNVELLSLQQFDTEHSFLKKIRSFLDTRFGNKILIIQTDFVEDSQSSNLI
ASAKYSAINEINKSRDEMTEILVYFITKLPRMEGGTSYVGFHGVLARIGPWRSVHIDDLR
KSKDIVSDITTLKSLTISQLFEEREKPNKPEAMETDDTKMESPTLEENADLEDILDTTAL
VRSCVQSAVGMLRDQLEGGSRSTRRLEILLTLLAENEETKASFLKTMKRRLHALLVTHDE
NTPSPKNWVFKEASNIDALQEGGTFRHTLWKRVQAVVIPFLAQVISMIDRDCNLDLLVDS
NSVESVKKLWLEIFGNLKLLYIPYTKVDRNSESKTILVQNYMKLDHNLCSTMPFSWRIKD
HLDELWVHVLQREVSQGHTHNQLEEFFKKTPLGRYIADADEEMQKEFFHRYLQDFISMTM
KVTSPDELMLLRSALLSCVNELKIRSNANKEKVTSLPWVHTAYHEFKTRLQNLSRMITIE
PQVAQFLQRKMQSREGAEMVLDVYAAVACVELLEPHNLDTDGLCLEWLRRVKRLQVPIEL
VCAEECVQNYGSRSQELVKFVRSGWNRIFSSSLFVEHVLLGIESVQKDLKVLVVTHARKL
WKSLEQNSDFKMEQPFLAVIEVLKSCKDEASERLFRFGRQLCAVCLGEPTDPLCLPCEHI
YCLVCIKQWLLPGQMYCPLCMVEVPQNFELKVSEDIRHLVQLYAQFRKRCNAFFIDMVST
LCFKDNSPPSDSIILHLLSFLMVDTNAVPNIKKGRRVYTKALSPFNDSVDKNPVVRSVVL
KFLLKYSFDDVKRYLQEHLSSVEQSNILEKTDKTKLCALYINCLEDSMYEKTQSQTELET
VASLEQETRFLQCCVQNTEAGPEKISIEYLQSIARIRLCLDTAACLLVKDLSGLGEATGT
QQDPEVYRRISAFLNHVMEFCRRSKNDWYRIYMIRKICNQKGMEFVQTLLTKPEFHWLFP
EEIVQQNEHTGQIDQYLVCGINYQAFRDAVGRAMIECKTEGIEEANKNCRSPLQKKTARL
LLAIFREVTTLYRAANQNVHPKPEQCQAIEDFIKGSQIFGSPELKNLATSLVYNRLGDLS
VRPDCTSSEHAITELAIHLTTVLLCGQDGILTPLKQLALAPVNMQNAFLPTMPEDMLVVA
VQVLGNLQWYSCPNGHPCTIGECGQPMERSHCVDCGAVIGGDNHRAVQGFQQTNFTGDRT
QTGHVLGDARRRDNPDMLDTKSMSPAPFILIRLLTHLAMLLGASRDPRSISQMIKPAVQN
PHVFLVNHLVKDMEQLSRTLGKGTDDSVNIVHLLLSRLLEPHQAQQWPVPYDNILSTKEA
RNGWETVIATEIITPQLKSLERRLKEVNDLIRKDSRVSSSPIMKVIYGDPHIFLKALPLD
KIFHCSAIWSCRERVSVQNLAHIVEQHDGKDTLPVLWKFLQKEAELKLVKFLPDILALQR
NLVRKFQNVTEHMHKTIGDFIQSQKAESLKAWYETRICTFLTVWNQLRASLVTNGEIKIS
EDYCKEDLNLDSEFQVLLPQRHGLGLCSTALVSYLIALHNELVYTVEKHTGEENSYSVSP
ADLTDLHVIKYEVEKDLIPLILSNCQYSMEQGQETVLEYDLHKTQQQILNHFLQGKPLIT
LTGIPTLVNRQDRNYENIFKDVKGKLMQDSLPALMLNALSGELQSYTDVCEALSVVEVTL
GFLAMTGGEAEMQLVKYVQDILQMGDQTAPHILKALSRCTLKHSIALWQLLTSLKSECML
RLKRDPFLEISKVYKKPLLDGDKKLLTGFLTKGCVDTFVLEMHEFLLLNLKKVNAPEEFR
PDWSLKHTLVSYIERKDLDVPPDMEEILPEETCLSQFVETWKFAVAFRQERHQR
Download sequence
Identical sequences W5N459
ENSLOCP00000015418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]