SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015533 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015533
Domain Number 1 Region: 332-509
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.97e-34
Family BAR domain 0.0069
Further Details:      
 
Domain Number 2 Region: 95-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-25
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 3 Region: 706-766
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-16
Family SH3-domain 0.00028
Further Details:      
 
Domain Number 4 Region: 569-646
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000236
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015533   Gene: ENSLOCG00000012616   Transcript: ENSLOCT00000015562
Sequence length 771
Comment pep:known_by_projection chromosome:LepOcu1:LG4:59783345:59814524:1 gene:ENSLOCG00000012616 transcript:ENSLOCT00000015562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMDPKEVKENDFKGFKRRKGLFLKPKMYLERRKTDTIVAEDNSKGDINIGTLVRRSQSDR
TEYSIKLKEKMAPQERSAPASPASPALNPEEVRLRKMSRRSKVINELIQTEKDYLTDLEH
CIKEVVEPLKEAQVVDVDRLFTNIESVRKVSAELLSRLQDATEEQDPETQIISETFIQSK
EALEEVYKIYCYQHDDANSLLKSYEKDAEIQQHFRTCISSLKLIYKMEGLFELHDLLHKY
SSHTIPCVILSLMLLHTYGRRNIKNQDHRQLFQVVDIQKQRKNKSRKGFFFLLSEHRIQE
EGTLKSRINKLNIHSLKKKSNRVTEYLKILSGVEPQVKDEIFDKEEKVFRNLEKAVRQLV
KNVCCYLHYTQEIMTVAVQNVQDLENILQDPEKLSTNGLNCKKNGDNPYVHYKDKLERLV
LMPLSMLQAMFSAPQKLIQKRHDKLLDYCSRLERAASDELGCARRDYEALNAQLVEELQR
FNTAAKKILSNSIYCFAALFRDLMDSARQAAPPIQLLPAPLSNLSEVQNSIMEELNNLVF
VKENAQKLMERKVSFEKSRKVLYETPRQTEAQREKLISSYPADRLYQLKRNCNATQEHDV
SLFEGELVAVEEQKDPLGSTSRWLVNTGSTVGYVYSSFLKPYNPTRELNGSIPEQQDDFD
NISLFVSGSGSNSLRSFCLTAGDSSSSISGLQSTADLEADGIDDQQSETLLYYAVYAFQA
RCEQELSLQEYQHVRILKFCDLSGNKEWWLAEANGQKGYVPANYLGKMSYA
Download sequence
Identical sequences W5N4H4
ENSLOCP00000015533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]