SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015710 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015710
Domain Number 1 Region: 145-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-97
Family Protein kinases, catalytic subunit 0.0000000000629
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-23
Family Pleckstrin-homology domain (PH domain) 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015710   Gene: ENSLOCG00000012762   Transcript: ENSLOCT00000015740
Sequence length 480
Comment pep:known_by_projection chromosome:LepOcu1:LG7:16306636:16377844:1 gene:ENSLOCG00000012762 transcript:ENSLOCT00000015740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKTIQAVADSLQKQEEEMMDC
RSGSPSDNIGIEDMEVYLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQSSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEERARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEDIRFPRTLAPEGQSLLSGLLKKDPKQRLGGGPDDAKEVMQHKFFAGIVWQDVYEKK
LIPPFKPQVTSETDTRYFDEEFTAQTITITPPGQDDNMESMDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences W5N501
XP_006632516.2.81211 ENSLOCP00000015710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]