SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015878 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015878
Domain Number 1 Region: 751-931
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0031
Further Details:      
 
Domain Number 2 Region: 906-1027
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 264-357
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-25
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 14-148
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000004
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015878   Gene: ENSLOCG00000012895   Transcript: ENSLOCT00000015908
Sequence length 1151
Comment pep:known_by_projection chromosome:LepOcu1:LG4:61985287:62078977:1 gene:ENSLOCG00000012895 transcript:ENSLOCT00000015908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVKQRRGDELFGPHEGRVQYSLQMVGFLPVHALTTLPMLPWIVAEIRRLGAREQVALHVS
PTSIRCVLDTGHGQQWDPLRYSVVFEHRPQHVCRLIHNSHDPSYFACLIREAAPGLREQR
TTCYVFCCADQAKKGPELSQTFTLAGQAFAEDNSCELQITSVAGSTADNRKLLFNLFYCR
HICTGHHKAPPALIDECIEKFNHLRTAEEEAGGAGSEPGSPATSSRTVFFRTEASLPSLQ
ALDENGISPELQKRNMNGPCGVQPTNIQENRTMLFTIGQSQIFIVSPDTKKVAIEKSFRE
ISFCSQGIRHVDHFGFICRESLENGTCQFVCYVFQCTNEALVDEIMLTLKQAFSVAAGQQ
SSRTQALQCASCPMQHLHRLCARIEGLHPSKAKLELQKHVATLNNKDQASIFERTQKARP
KSEQEENELVMSNLRLLYEERQRTHVHSNNGDLKQSSQNVPEDPPTEMSSSRIRLEQLKS
RAKKSLTESLEGIWKGNSRYRGQKESFESVEAGSSSSFTTLSSNSREPSLSEATVTPVAA
SPLKAHSSTGDLKLLESPSPDLQRLAFRRRANTFSHLPASHQPPSQALEESPSVAKPKLL
RHHSVGTETPHQRNDLDIRSSPGRDGSDSPMRIRRHSWRQQIFLRVATPQKSCDSSGRYD
DRSDAGEAPPRAALGPGLCEGLLGPVAEERKRTRQELRELWRKAILQQILLLRMEKENQK
LQASESDLRNRRLKLDYEEITPCLKDVTLVWEKMLSTPGRSKIKFDRDKIHTAMGQGVPR
HHRGEIWKFLAEQYQLAHLVPNQFPPKGTPYKELLKQLTSQQHAILIDLGRTFPTHPYFS
AQLGAGQLSLYNLLKAYSLLDPEVGYCQGLSFVAGVLLLHMSEDDAFEMLKFLMYDMGLR
KQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEYEISPSLYAAPWFLTMFASQFPLGFV
ARVFDMLFLQGAEVIFKVALSLLGSHKPLILQHDNLEAIVDFIKTTLPNLGLVQMEKTIN
QVFEMDISKQLQAYEVEYHVLQDELMDSPLPLSDNQKMEKLEKTNSSLRQQNLDLLEELQ
MAHAKIHSLEARVENLVASEAKLKQTVRTLELERAALLDTVAELREYISTLNTAEDSTGQ
PGPEKLETDLS
Download sequence
Identical sequences W5N5G9
ENSLOCP00000015878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]