SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015879 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015879
Domain Number 1 Region: 21-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.59e-76
Family BAR domain 0.0000000592
Further Details:      
 
Domain Number 2 Region: 297-356
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015879   Gene: ENSLOCG00000012899   Transcript: ENSLOCT00000015909
Sequence length 359
Comment pep:known_by_projection chromosome:LepOcu1:LG3:38597282:38609161:-1 gene:ENSLOCG00000012899 transcript:ENSLOCT00000015909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSFCPQKGSQISQLFYVLVLQLFSEKISGAEGTKLDEDFMEMERKIEVTNKSVMDLLSK
TTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGILGDCMLRYGKELGEDSTFGCA
LVDIGEAMKQMADVKDSLDIGVKQNFIDPLQTLQEKDLKEIGHHLKKLEGRRLDYDYKKK
RQGKIPDEEIKQAVEKFEESKELAERSMFNFLENDVEQVSQLSALVEAALDYHRQSLEIL
EELNNKLQSRITAASNRPKREFKPKSIMTSLETIDNQQHNGLSYSSSFKSSGSSVHMDQP
CCRSLYDFEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDVIVPLPQ
Download sequence
Identical sequences W5N5H0
ENSLOCP00000015879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]