SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000015955 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000015955
Domain Number 1 Region: 23-176
Classification Level Classification E-value
Superfamily RUN domain-like 5.49e-38
Family RUN domain 0.00053
Further Details:      
 
Domain Number 2 Region: 1397-1508
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.44e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1198-1265
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000015955
Domain Number - Region: 842-870,925-1139
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00471
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000015955   Gene: ENSLOCG00000012949   Transcript: ENSLOCT00000015985
Sequence length 1510
Comment pep:known_by_projection chromosome:LepOcu1:LG9:47853256:47888091:1 gene:ENSLOCG00000012949 transcript:ENSLOCT00000015985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CMMAASVGESQLQRIIRDLHDVDAVTELSKEYRESGEPITDDSPNLHKFSYKLEYLLQFD
QKEKTTFLGTRKDYWDYFSDCLTKIKGANDGIRFVKSIPEFKTSLGKGRAFIRYSLVHQR
LADTLQQCLMNEKVTSDWYYARSPFLKPHLNVDIINHLYELNEVQFDIASRGYDLDAAWP
TFARRTLGLANSPSHFWKPPSRSSSISSLVSGYSQQAHDIPSSPDFNHTLMSEPTSEVDD
LRLELDQSELKQRELQDRIQQLEREKQNLLRKMVEDLQKQLEVALSSQRTVHDLQQCLKT
LEDNSSEKQRELEKINKDYAIQLVKESSASDLQAKIGSVEQKNVELLAKLDGVLSEKGQQ
IARDYDSAQKIHELLDKLNKAEKEKTEAQKQSEERGKCVEKLTEELSLKHAAARESELKL
GMLSATAEEERSKVVRQVEDLKAAIEKLQGALTIKEKESSNLQMQLQDAQSYSETLEKKT
EELKKKALEENTELQLKYTNVKEILEGQISSLTEQLKAKEKEFSTSNKNVQHLEEQIKRL
INEKEGLNNTVLELEANVKEQSIQLEDYKTECTNLKVQNEKFLQAAKRNEDLNKELMENR
AALEDQLACLRASEKQLRSQIEDAKVSVDEKEKKLREENRHLDESYQKAVMQNEVLEEGL
KKLEVENEELKQEQANQKETFSARQVELRSAKHMVSELEKNITALKSSENFLQEQLQSKC
SLLEEKEQLCDELLGKIEMYENKVKEMETEKSKAETVCAQQSELIASITAQKAAVEKVQL
DQKANIAKEVNDVKTKLLVTENQLGLNVQEVSRLQAEVLDLRSKVQSVSDDKLKAQAKLD
VTEASRDEFKILTEQLKEQIEQLNREHVQELLSCKEKEERLRKEKECETAAKADLEKDVA
SLKEQLATLKKHNEKFVLENTETKECLHRANTEMAELGIQICTLTSENEDAKQKWTSISH
QLQELNEEAAKEMDRLNASMAALRQENDSLQEELRQSESLTSTILDLQSKLEKAERQVKN
LQDSSKEEVSAVKFQMSSEIINHQNQIKNFKEDLETVKEHLKAEQEKVSDLKAKVSELKA
VSTEYTQQIEEKTAEVSRSELVIQQSNEELERVKESLARAQEALSSAQKESQELSEKLNN
LMTEKEKNDLQMSAEIDDLYRTKKNLEERLIELIRDKDALWQKSDALEFEQKLRAEERWL
VDKEVNHCLGCQSPFTWWLRRHHCRLCGRIFCYYCSNNFVKTKHSGKKERCCRECYMQHS
AVVERLPAAEVASPPETPTDSPKDLGQLPRRLTPSVVVTDAAPKPDDAVFDIITEEEVNG
IYDSDSVRDSPDSTREMEGQQRSPEVNAAVGESTPDDLGEQMPTVQDAEICLLKSGELTL
TVPLTIETIMQFGEGGRELFIKSSGYSVIPIDVEEAGPTISWVFSSEPKSISFSVVYKES
GDSPIEQAKVLIPLTRCNSHKETIQGQLKVRNPGTYMLIFDNSFSRFISKKVLYHLTVEK
PIIYDGSDFL
Download sequence
Identical sequences W5N5P6
ENSLOCP00000015955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]