SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016002 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016002
Domain Number 1 Region: 4080-4127
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000331
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 2763-2999
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000958
Family ABC transporter ATPase domain-like 0.072
Further Details:      
 
Domain Number 3 Region: 2421-2563
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000434
Family Extended AAA-ATPase domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016002   Gene: ENSLOCG00000012974   Transcript: ENSLOCT00000016032
Sequence length 5265
Comment pep:known_by_projection chromosome:LepOcu1:LG10:37553629:37596803:-1 gene:ENSLOCG00000012974 transcript:ENSLOCT00000016032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPPGDQPQGQAVGKEHGDLVLEPDTCGASGESNWRERKKKDSEVPAVPGPQVKISQGS
LVEEGGSKEQSPATQTGCEMEDQSRMDTPHHLELMEVSSVGGAKTNPETRGGCSEGEAIV
LVGNGNPTAKESSTPEEGTVTIKPSASSDGHEPGKSSGRRQRKKEKKKLKAIERKGNTKP
AAALIDKTQGKEEEQSGNTKGTQTEDRKEEAEMTKTQPEIRQLRTKDKSVQTQPKKLKTQ
ETQTDPMPELARNMQEKTEQEQSEATGTAQQAGQSEFSGTRRKKARNSETGRLQVGSEDS
ASAAADAQRQQEAKPESTVTAEARQPSKDSGKDSKELKEHEKSSEEISNQTTAKEKQCQE
KASQKLSTGKNPRDAHIFTIYINAVLDKKFRFNTQSDKLLLLYSNGSVDLQINYFRGLGK
QGYLIEAQFSVEKWLLTRGEIQYKYAVMKRGNRIEEMAYQRKLIPFDSQLNEVHLYEGHV
HFNSLTYVERLLGLFKSKEEWILMARLDAGDILLHRIFEKLVPSERESITCFIEHLQALM
WQIKTASQREFYPGIHYCQPTDLSQCIVKHLLQLLQRGSDQSTAMHNPLVLGVIVFQVSC
ACELQLAAKDWAAVCRLLCFSSAQNSSHLLELKSLFQNCRHIVVGLMNRCARSVVVELPL
LVPLLHALREPSEGGTRPERGRIPEEQDWAGLEGVDFSIYRSLIRSISDKRRMMLDLMDA
HKSLGGESPQVLHSWLSLVATEDIPKYSRMMGTALEHVVQNLHYRLKECGIRTLDKDVPA
VGETIEHMLEKLDEEKERILSSGQLDYILMCCINNHKSVCKMARLVQHYKVAVASFQLVL
KVAEIQDSFLGKDCEGDSSERSRLLEKLSGLQSELLQWRESLLRLPLFSRERRRLSYPKE
PELWDSLLGVKCAIQPLSDQWRGAVEKDLRKRICQAGDLQSIAVCCCEQSALSKTCPTVQ
TCFRELCQSAIQVVCQNEKEGELLHFLNPFSMEIPSPILSSIILESTAKAGEDLTGLLLS
RQSSLSYLLSQGVWQKLQVDEKALQTLERGHSALASLVEGLLLGTIPLGHLTIILQNEDH
FKKLYHQENKLSKQDFFHGSAEKMLRQREADLQAFNQVKEHMDNLIKMISRISESVTVED
LSHLKQQHRAELQSVSLGDLVEVEVHRPELELHEQAPRAVKWYIVCDMVRDMAREMHQLR
DSTLLLSLWVQMAVSMKDGQLTSIMTLRKVQADIWKPLLLQYRQLGLKIARGTVTFQELD
KALQESGDRGEGAEMKRELQLMASLLEDEGLDVEWTQTRLTQIQQYRQLHAAAWSASAVL
RIAQKLELSGDFTQIESLTQLREDSFKKRNLKSLTSELICAKEQLAGVTEKHTICLEEFL
NCQSLVNWVKINLEGMSDLKVFVDLASISAGENDSEIDRVACFHDAVMGYSPFLYSLKSS
DNFERFMACAEKVWEALRRDEKLPEKLRDSTRWLDWLKGLRETHGSVEQSSLSLATAINT
EGVYQVGKLHSQQGKQSLQSILQVAVKKDSVEKSYSLEELLELQNKLMLMSSKGEHGRTQ
VNRFMQVFEGVQRLGRILLQLHSSGNMLFREWKAFIHCNQDHQPCIKVHFAMPMMEAIEY
SGELEEQLQEVCRSVEFCHRDWCTFISEMRSQFYPLNYYTSEQIVYLCHQLHNCHTKKLP
QQVLALLSFVKPGCTLKDIRVACSTTPEVSSEPSTEDENSISSEHESAGSRHEEEPTEVI
DYSDDEVGDDYNFDVVYNSDYEEEMVSLEHFSDEEKQWETEIEISMHLSGKEACVKEDPI
ETVEDLWKHFKENMAGSLSEHLDIITLGQFLSCLSDINKQEIKRKLCPVLQEGKPNLVLC
PESDVLSTALSLYVTSPDQPLPSSDELLLCREDTTAEVVEIFLRRALGQGRPHDQEKIFT
LVNPGLLTYDVGVTVGEQFEALERSSHPKYHLLIVSSVKHQHRYVPSFFSNCKVQAGVAV
STEKAKSYLKRHFTVKLEKSHVLHAYPEHLSTWVVSSTRPAVGKSLYVTRLFERFQEMSS
GAQLVRIRLIEPRIDPYLFLKSLTDGLVPLKEHDSAVVHIDVAAVRTGLEVFLFEVLVLG
CLTNSEGKLWRRNPAHLFLIELLRTGSTRQIHAEQSKQGLLDILPTILCRPPKEVRTLEL
MRRQGTLQRSLDPLMDMQVFASDGVQRPYQYLKRYNGKQSLDDFTYQKGFIEGDPSDCLY
YLLAYCGVKDPSWTELRNFTWFLNLQLNDCENSLFCDPVFVGNHLLGFKSFIVKFMILMA
RDFATPSMDVSDQSPTFSSTDEDNDILAHLTIRKRWESESHPYVFFNADHFTMSFLGFHV
KRKHSGACDAVDPHTGEVLMGNVMSSELLEGLQRQGISLSEDFDALPREDKIQRLSFVVG
AKKGWIKGQFDPDPTYELTADNVMKMLAIHMRFRCEIPVIIMGETGCGKTRLVRFLCDLQ
KGGHPTENMKLVKVHGGTTAEMIYQKVEEAQILAKKNKNQFELDTVLFFDEANTTESIFA
IKEVLCDRTVRGQPLKPNTGLKIVAACNPYRKHSPEMIRRLELAGLGYRVKAGETEDRLG
NVPLRQLVYRVQPLPPSMVPLVWDFGQLSDFAELSYTRQIVQRQARDHALPPTCTETVSA
VLAASQRFMRSRRDECSFVSLRDVERSMKVLIWFYHHSSLVFHNYDHLNSNEKILKCLAL
AVGVCYYPSLVSKREYLNCIYRFFPEPLNRPDFIEKEISSCQDVFLENIKTRDTVAKNKA
LKENVFLMVICIELRIPLFLVGKPGSSKSLAKTVVADAMQGQASHCSLFKNLKQVHMVSF
QCSPHSSPEGIIGTFWQCARFQQGKSLKEYVSVVVLDEIGLAEDSPQMPLKTLHPLLEDG
CIDNDRPKPHMKVGFVGISNWALDPAKMNRGIFVSRWDPSEHELVETAKGICSSDNTVLI
KIQHLFPKLASAFLGICKEVECNQFFGLRDYYSLIKMICALVKASQEEPTESQLAEAILR
NFSGRLEEFDPLNYFQDIFQDSRKVTRPSTLWMVEKNLDYRNQEESRYLLLLTTNNAALH
ILQQSIFSKKDRNPPEIVFGSGFPKDQEYAQVCRNVNRVKTCMETGRTVILLNLQNLYES
LYDALNQYYVYLGGQQYVDLGLGTHRVKCRVHRDFRLVVVEDQNKVYTQFPVPLINRLEK
HQVDRRADLTTYQKRVLKKLKDWVQEFIFVDGERKEFHPHDVFIGFHEDACASAVLQAME
CRHQWRDKEVEGLQEDLSVQEQSQGTGTDVEMEEHGEFGGSFEDTIGESQKCDTGDSGVQ
AEEQNDEPLEEQIDIEMKGREGGDPIAKVKNEQQMEEEGSERVMEENESMMEEGGIVKCS
EEMEEDEVLEAAKCFLLSCATPDSVLRLKYSELSSQEKKMLQRMYFRQQHHLSLRDFMEN
HMNKTEDPNRFIEVTTYSSLLTQSDVRAVAQALSLDTSGILLLSLHQFDTESSFCSNIRN
FLREDRASLRVLLVQTDVEESAHCDELIASAKYCAMNEMSSVGTRMSQCYMVFITKLSRI
AGDSQYIGFQGGRWLSVHIDDLRDTEDMSSDLSAFCGFPISELLTSSSQPEQAGSLGDSI
AENQKGSSAHLDCVSLLKSCVQSAVALLRDTDDRASRSMECVQILLGLMGKKQGTPEVRF
VQVLLQRLSQMLALKEEMVPSPEEWVSKEARKRQALQEGGTLRHTVWRCLQATITPVLAR
TVEVLDRDFNLDLLQKSEPGNWLTQMWIDILEDHQILEDHLILPQNQSVVNEEIPVQRHL
WLGKQAQPCAAPFSWLIRLQCESIWEESYYVPGTEEDSGQRILQFVNSFKSSRLGSYITK
LAEEEQRELGHRFLKDFLLLSINISSQEELKVFTRAVLNCVSELQQETKVSSDLSPAWIV
AAFRHFGPRLVNLSHILQLQPHVTRILLEGAQSGSPEMNEDVVALGVYAEAIERHATGTL
QECRSLLQSVRQLQSCVERACGQNYSTLCSPGCLKQLDTIRSLWQGVLVIAAFIQQVVVR
VSMTGNQRLEALALKHCTLLHKFMQGSPELRNRDALQGLMRVLHSCNEQSSHLDFRYGIQ
KCPVCLLAVSEPAILPCEHVFCLTCIQHSIDGDRLFCPQCKTGLPADYQPAVSDKLKGAL
QHHEILRRQCNCFFLEVVSRFCLAEETCPEEGVVELLFSLLISAQGAVYRTRELSPFLEC
VDHSPVVRSVLPKLLLHYSFEQVKGHIQRYLQNLERNVLDREDLTELYLLFVNCFQDALL
SPGQEEGHVSQKQLQGATHFLSRVARRQTAGFQEDPAEFIQTMARLRLYLGTASSFLKNT
WANPGSELVEGYLQQVRAVCEYSRNDWYRVYLLRAVNRLAGMDCVQALLRDAHWHWIFPA
QVIELQSHAPAEVDRFLCCGPHYKALRDDLCGALLQSQTDPITAALQELDCSSSTAPVLL
SLALFRQVTCLYVSSDPRLQPKPEETGLLQDFMRISPLHLSREYQEFCSALLTNELGGRG
SSLSITPALSAQRRTLLEILVHAAAIFLTGNHLLSPLQQIASQTQTMKDAFLPTMPDDHS
AEVHRWMKEKLHSYRCVNGHVCFVGECGRPVVTSVCLDCGAPIGGIRHNPVEGFIRADII
EDQTRTGHVLGEAHVRSDVPDRQISLAAFSILRLLTHLAMLLGAHCSLQGIRDMIYPRVM
DVVPFLWRHLEKDMTVLGKALDKNMDDTAITVHLVIHAFLGCTRGSSDMSRALSSKQARQ
QWEKLVCNAVIKPVLQDLEQKLTQAHGQISADDRLSGSVLMKVLYGNPVSILTLPSDSPT
DNSRFWTCPERLTLERFTQVLDQSGGWEGYPLLWLFLKKAHCIRHLSHLPELAALQTDLL
RMFPHVTVVGSQSITQILQQLPTGYQKKVLKRRVKVFINVWNQLRTEIANSKETGVQQEL
CEADLSTDSSAGFLSLCRRGPGSCLSTLIDFLTETHNSLVREARKEAPETDSNYTVSLEG
ASETQLALCHPERELLPLVLAHCHYTLKKGQQTVSSFDMQGIENQLSRSFLAGKPLIMTN
TSKYLNRHQQDFSQILAGVRAKIPQEPLKGSVSSAMKTVLRSYTDVCDAVFAVEIGLRFL
GKTGGEAKAPLLPYLRNMLKMGKQVSSTVAKALNECWLQHITSVWQLLTSWKSELMLQKG
KDPFERLPREYQQRLTEEEMRGLRAFLRVTDISTFNLELHEILLLKTNNPNPETNYQPHW
DLCSTLENHLENKHCPALPGLEALSDSLTLNKGPDIWRLAVKFRS
Download sequence
Identical sequences W5N5U3
ENSLOCP00000016002 XP_015211977.1.81211 XP_015211978.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]