SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016038 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016038
Domain Number 1 Region: 8-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-68
Family Protein kinases, catalytic subunit 0.0000694
Further Details:      
 
Domain Number 2 Region: 545-626
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-17
Family DEATH domain, DD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016038   Gene: ENSLOCG00000013018   Transcript: ENSLOCT00000016068
Sequence length 635
Comment pep:known_by_projection chromosome:LepOcu1:LG9:48731566:48747055:1 gene:ENSLOCG00000013018 transcript:ENSLOCT00000016068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGAMALESIRMSSTDLIKKEPLDYGGFGQVFLCYHQSHALVVLKTVYTGPPRNESSKKSL
IYEGNIMHKLNHERIVKLLGVILEDGAYSLVMEYVPKGNLLSMLNNVSVPISVQGRIILE
IIEGMVYLTNKNVVHKDLKPENILLDDDFHIKIADLGLATCQTWSKLTKEETRRQSRLGN
KCAVGAAGTLCYMAPEHLESIHARSTEKSDVYSFAVVVWVILTGREPYENARNEEHVCMC
VRNGDRPDLSAVPRSTPQPMTTLMVQCWHQDPNQRPNFAECYDIFRPFYEEQLENSVEQD
VLRLKNTYAGPEAFVEKVKSLTTEDSSLPADSPASLRSSADRPVEASVEDLDFHSAVGSI
QADAAPDLGLLERKLEDELNYHNFGSRTQSKPGDGLGKPSSGIEYAPCLSLQGPNRRQFA
VMVTWAKEMAHRPYSSPPLISRKPVSNNNMAWPICNNLEIPYTPQENNLHCKNIWSAREI
YPQNKSKYFLVQAGSWVIQNVSGLQIGGNNHMSIASQSFGSPHHPSGALCDNISSEMLQK
YENYPVQEQHLELLRENLGRQWKHCARRLGLTQAEIEVIDHDCERDGLKEKVYQMLERWK
MREGCAGSTVGKLYRALGDSLTDELINRLLHVCQG
Download sequence
Identical sequences W5N5X9
ENSLOCP00000016038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]