SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016194 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016194
Domain Number 1 Region: 15-189
Classification Level Classification E-value
Superfamily RUN domain-like 6.28e-39
Family RUN domain 0.00086
Further Details:      
 
Domain Number 2 Region: 542-658
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-20
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 3 Region: 692-801
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000951
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016194   Gene: ENSLOCG00000013146   Transcript: ENSLOCT00000016224
Sequence length 1070
Comment pep:known_by_projection chromosome:LepOcu1:LG15:7481766:7497412:-1 gene:ENSLOCG00000013146 transcript:ENSLOCT00000016224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISTHTPESGPEPKEVKQGLKTTLALSLKELQKRYVNSDAAVTSDDGDANVLCSALEAVF
IHGIKTRHIRTEAGGRGKKAGSRAPLPQPVFWTLLKTITHRDVTTELEHLNFINTDVGRC
RAWVRLALNDGLMECYLVSLLRERSKLCEYYQPAALLLDTEDREVLLTYLQGLTSLSFQL
SYKSAMLNEWTVTPLVMAGLVPSSDSFDLLTSSNGDAKCKESWDSVSQSSGSDIIEVHHN
SGQGLSQGRNSGKTKLTSSNLSLDTTGSSQLSSSQSSDSLPQVNGHKSPDTALEEQWSHA
FDVISDEDPGKPVKEKGEVTSVTCSVSPSPVILALSERLTEGASSTPDPTREDSYASSQP
PDHSLSETAESSGTDSEAASPVSPAAPPVEAEPTVAPPPEPRPENAGRGAPGPTQPPASA
RAPEFPVLKQEKKRRLKLKTPLPEPHACVSEERRPEATPRTPESSPSRKESVDCLYSPTT
GLPKYPSWISEDDFYKPCPEETPKTKDVLGFIDSHENGGGSVGAEPEWAPPSVVHRKGTG
LTNLFRGLLKLGNLERRRGPVGMWREYYCELSPYEFRLYPDEEERSCCENCSLLRCESVR
APSSDGRFELHFTGKRLYLRAPSQGEAEDWVDMVWEAVNKCRPAQPDDQWEILPDPVGRG
EVGSGPPSSASSPPAEQPGQGGSPPPLLSWARHTEPEQDAIKETVLYLLADKTWAPYVFS
LSLEALKCFRVQDQKKIPHSTQQIESIRDVVPDTTLGSPAFFKVLTTKATLKLRAENEEE
ARSWRELIRGALNCYLETSEVTAAGDSAGSTIHRLVQHSLKGNGVLLPYLCTVPTEKGLD
VQNFRCAGCSRQIGFSFGRPRLCEYSGMYYCDGCHRGDVSVIPSRIIHNWDLSLREVSRK
ALRFLSQIAHEPLIDVESLNPSLYDHVEQLKQTLSSRQKLRLLGEYLITCRSGGMKKMQA
QLNQRNYILESAHLYSVADLQQMVEGQYEAFLQSIIQFASNHVYHCDLCTQRGFICQICN
HSDIIFPFEFESTTRCQKCKTVFHSTCKKQNPACPRCQRLQKYLERELQD
Download sequence
Identical sequences W5N6D5
ENSLOCP00000016194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]