SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017747 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017747
Domain Number 1 Region: 21-100
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000306
Family Pyrin domain, PYD 0.027
Further Details:      
 
Domain Number 2 Region: 176-274,309-356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000714
Family Nucleotide and nucleoside kinases 0.076
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000017747
Domain Number - Region: 582-646
Classification Level Classification E-value
Superfamily RNI-like 0.0306
Family 28-residue LRR 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017747   Gene: ENSLOCG00000014418   Transcript: ENSLOCT00000017779
Sequence length 651
Comment pep:known_by_projection chromosome:LepOcu1:LG1:650814:659343:-1 gene:ENSLOCG00000014418 transcript:ENSLOCT00000017779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKTEGLDSLTLDRGLVVFKLLSHHLADLTTEDFKRFRHELRYSKQDEHRISWLELENAD
RTDTAHLMAERFSSQAVEVALDVLKSINCASTAHSLRTEWEKEVGTQSGTSPDYQSEYKE
AVQQKHGKVEPYEASPWEEHGLSSSYIRLHLQTKGGAGDLAGRRRQLVRQRTTDRDCEDL
ETLLDSGRPQVLALLGPAGMGKSYTAKKVMLDWAAPGKHYSAFDYIFLLDCQKLSRRAQD
ASLAQLVCEECAALRPVLQSVFESRVLIVMDGLDFVEFATGEVPEMDAFSKKPISVLLQG
LLQKRLLSSGQHYSLLVTIRPAIADQLKKCARVDQWVEILGFSEENLQEYFQHQGLAAQA
CEEVRSNESLLSLCAVPLTCWVVCTLLKQQGEGGEGLLGAPTYSITCVFISYIYIILKHH
HSSSSPEEAAGALRSLSRLAKDGLARRKREFDVKDVEAEFGGVHRVPTSFLNKCGYRCGV
RRVEVYSFTHPALQEVLAALFYASDASTGPLNGFLSASLQPGHAHQRDMVQYLFGLCHPH
NWALLAPFHLASSASLTPRLKNWMKEAVTLTNRNPEDTYFLLDLLLCLYEFQEEAFTTQT
VGALQEVRLQCVFLKKRDFLALRYCLQHCQASQLPRLLLHFCNLRSKEAKK
Download sequence
Identical sequences W5NAT8
ENSLOCP00000017747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]