SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017758 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017758
Domain Number 1 Region: 480-778
Classification Level Classification E-value
Superfamily L domain-like 1.7e-45
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 24-439
Classification Level Classification E-value
Superfamily L domain-like 2.49e-43
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 3 Region: 874-1019
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.15e-27
Family Toll/Interleukin receptor TIR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017758   Gene: ENSLOCG00000014430   Transcript: ENSLOCT00000017790
Sequence length 1039
Comment pep:known_by_projection chromosome:LepOcu1:LG5:50478835:50482640:1 gene:ENSLOCG00000014430 transcript:ENSLOCT00000017790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPQASPRGAAALPGFLAVLVSLLPPGAATYPPFLPCGSPSPQTVDCAAHGLTRVPLFRA
PTGAVTALLLSGNHISRIPADAFALFRRLETLELQWNGLLRPGVPKAGGPMVLAPRAFEP
LAQLRSLDLRGNGLRAVPLLPPSLRTLDLSYNRLLLLEPPARPPALAALQTLRLDGNCYY
NNPCGHSQGAPRGFLAGMGRLRELSLGHNNLTAVPGGLPAGLRRLALHYNQISAVAPGDF
GQLARLSSLDLKGNCRRCEHAPSPCIKCARSALHLPAGCFASLGSLKSLNLSDNSLASLN
DSVFAPLRGLEELLLSDNLLSRTSPNGNDLVLGSPAFRGFPRLRSLDLSYNYRRFTVFRR
LALTEDFAGLARLQSLQITGCFFQSVDNASVAPLAGLPELRLLNLRLNFIKNIELHIFDS
LAGLSYLRLSDNEISCTRCRGAPGKRPGLPDHRLTPGSSLQARGLIAPEPQVGLPLPESC
TGRETLNLMRNNLVYVQKELFEGFERIECLILSHNSISQSFNGNQFILLKRLKLLDLSYN
RIDLYYKAAFSELPSLEVLDLSNNNYHFQLSGMGHRLDFIAGLPSLRLLDLGFDSISDRI
STALASSSLNKLVFRHNRLQDMWNKKIYFQFFRNLTNLTSLDLSNNLLTRIPPEGIYHLP
PTLRDLNLKFNKLTSFPWEALSAFPCLEILDLSYNWLSTLSRSLHPGSYIPPDSGLRSLN
LSSNRIHAIDRDFFRNATALASLLLSDNQLEQLDFDNFLLQRLRVLDIRWNRLVCTCDSS
FYELFGNFNFSVPALTSQVTCGSPDKLRGRSVFSRDAPLCPGSRNMAAFLLSLALALPLT
ALPVLRQVLGWDAWYAFYVWVARAWGLFYKGGEGSAYDAFVAFDKEQESVADWVYNELRV
QLEDSGAQRFRLCLEERDWLPGRSSIENLHEAVQGSRKTVFVLPRAGPAGGLLREAFFLA
QQRLLEERADVAVFVLLEKGRRGSRYLQLRRLLCRETVLLWPQNPQAQGYFWHRLRCVLG
RDIQASYDRKHCRGVPTPL
Download sequence
Identical sequences W5NAU9
ENSLOCP00000017758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]