SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017780 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017780
Domain Number 1 Region: 27-139
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000306
Further Details:      
 
Domain Number 2 Region: 238-335
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.05e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000292
Further Details:      
 
Domain Number 3 Region: 460-495
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000458
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000017780
Domain Number - Region: 150-155
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.018
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017780   Gene: ENSLOCG00000014446   Transcript: ENSLOCT00000017812
Sequence length 507
Comment pep:known_by_projection chromosome:LepOcu1:LG1:895331:912031:-1 gene:ENSLOCG00000014446 transcript:ENSLOCT00000017812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGAKPSKTQESCGSSLLSPQENERVFDVLGRKCVTMATTVAQLHMALPHSSSYWSLQH
CGVLCFVKDNPKRSYFIRLYDIKEGTMIWEQELYNQFTYSSPKPYFHTFTADDCQAGLNF
ADEQEAANFQKHVEEKINQRLNRLEKRQLPPPPPPSADERRSLPPLPPPNANGPAASPVT
PGPYPMATMDIQNPDILASRYRPAPAPAPAILEKGKKNKKQNKKKGSKLTKADIGAPSGF
THVSHVGWDPNTGFDVNNLDPDLKNLFSRAGISEAELADAETSKLIYDFIEQSGGLEVIK
QEMRRQVDQLSSPLRGQRGAAPGVRIPPFSRSAPPDPLPPGRQGPLPPGVTSHEQQSRRD
PGVLASVPDLGFCPCPSPATLTAQEMTLSFQTRHYTLPATATPHDSCHDRLKWNDCCPPV
SPQEAQVSWARGQGIVEVRAGQTLTHRAAPPQVTENPDLQPSSSSESNEGIVGALMMVMQ
KRSKVIHSSDEGDDDGADDEDDDEWDD
Download sequence
Identical sequences W5NAX1
ENSLOCP00000017780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]