SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017940 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017940
Domain Number 1 Region: 672-728
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 850-902
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 3 Region: 614-671
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000126
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 4 Region: 790-847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000392
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 51-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000746
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 732-785
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000902
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 7 Region: 561-611
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000693
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017940   Gene: ENSLOCG00000014576   Transcript: ENSLOCT00000017972
Sequence length 953
Comment pep:known_by_projection chromosome:LepOcu1:LG3:51316663:51464772:-1 gene:ENSLOCG00000014576 transcript:ENSLOCT00000017972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESFARILRIPVLLLLIGPTLVDCQHTVEHRKVPQRIGPQQDAADGRGEVSGSWGPWGP
WAACSRSCGGGVREQTRPCLAYPQEVARVPHGVPPHTLAPGRVVSALRPSVPLHRPGRPP
RSNDTHPQSAGGPAQSSRPGHRGSSEKQITPGRYGYGKLPYIVPLKTDTGQGQRAPRPRR
QRQASHPRRRGQGQGYRQQNPHPGYDTGNGIYRGSQSRTHHARTSIYQPAQSQYPGSGSS
LLLSPHLRYPGPGVTTIKCVGAHKQYKICNTNACPSSSRNIREVQCSSYNNKPFMGRLYE
WEPFNEAQGDQRCELNCRAIGYRFYVRQAERVIDGTPCDHNDSSVCVAGQCKSLGCDELL
GSDKVMDKCGVCGGDNTACEVVSGVFKHSLMNIGYHKIVEIPVGATKINITEMIKSRNYL
ALRSRSGRSIVNGNWAIDRPGKYEGAGTMFTYRRPNEITSTAGESVVAEGPTNEVLEVYM
IYQQPNPGVQYEFIVPRENLISPHPSPDRKPGSHLNGQFGLEGDADSREEGSDHPHGTRS
PSLAPEPPRRQREHNWKQLGSSECSASCGRGVRYARFGCVHRATHAEVADSLCDPATKPG
AVEEACNTLACPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRTFTTQANRCQHLERP
ETTSSCQLKICSEWEIRTDWSPCSVPCGVGQKNREVRCVSNVGDIVADEECNMKLRPEDV
ENCDMGPCAKSWFFTEWGSRCSADCGAGVRSRSVVCMTNHISSLPLEGCGNERPPEAMAC
NNGPCETREQWFAGGWGQCSAECGNGTQHRAVVCLRSSADGFTVLQPSDCSYLERPASQQ
SCYLKACGAKWYHTDWSTCSKSCEGGFRVREVRCLSDDMTPSDSCEPHLRPEERETCNPD
PCVSQIDENCRDKYFNCNVVVQARLCVYNYYKTACCASCTRVANRQAGFLGRR
Download sequence
Identical sequences W5NBD1
XP_015199263.1.81211 ENSLOCP00000017940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]