SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017945 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017945
Domain Number 1 Region: 703-759
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 881-933
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000379
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 3 Region: 645-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 4 Region: 821-878
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 52-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 763-816
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000942
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 7 Region: 592-642
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000719
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017945   Gene: ENSLOCG00000014576   Transcript: ENSLOCT00000017977
Sequence length 984
Comment pep:known_by_projection chromosome:LepOcu1:LG3:51316663:51445027:-1 gene:ENSLOCG00000014576 transcript:ENSLOCT00000017977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSQPDFFLLCRIPVLLLLIGPTLVDCQHTVEHRKVPQRIGPQQDAADGRGEVSGSWGPWG
PWAACSRSCGGGVREQTRPCLAYPQEVARVPHGVPPHTLAPGRVVSALRPSVPLHRPGRP
PRSNDTHPQSAGGPAQSSRPGHRTVPCFSHRGSSEKQITPGRYGYGKLPYIVPLKTDTGQ
GQRAPRPRRQRQASHPRRRGQGQGYRQQNPHPGYDTGNGIYRGSQSRTHHARTSIYQPAQ
SQYPGSGSSLLLSPHLRYPGPGVTTIKCVGAHKQYKICNTNACPSSSRNIREVQCSSYNN
KPFMGRLYEWEPFNEAQGDQRCELNCRAIGYRFYVRQAERVIDGTPCDHNDSSVCVAGQC
KSLGCDELLGSDKVMDKCGVCGGDNTACEVVSGVFKHSLMNIGYHKIVEIPVGATKINIT
EMIKSRNYLALRSRSGRSIVNGNWAIDRPGKYEGAGTMFTYRRPNEITSTAGESVVAEGP
TNEVLEVYMIYQQPNPGVQYEFIVPRENLISPHPSPDRKPDKWNVAVNNILNTFVSVSLD
SPGSHLNGQFGLEGDADSREEGSDHPHGTRSPSLAPEPPRRQREHNWKQLGSSECSASCG
RGVRYARFGCVHRATHAEVADSLCDPATKPGAVEEACNTLACPAFWDIGEWSECSKTCGL
GMQHRQVLCRQVYANRTFTTQANRCQHLERPETTSSCQLKICSEWEIRTDWSPCSVPCGV
GQKNREVRCVSNVGDIVADEECNMKLRPEDVENCDMGPCAKSWFFTEWGSRCSADCGAGV
RSRSVVCMTNHISSLPLEGCGNERPPEAMACNNGPCETREQWFAGGWGQCSAECGNGTQH
RAVVCLRSSADGFTVLQPSDCSYLERPASQQSCYLKACGAKWYHTDWSTCSKSCEGGFRV
REVRCLSDDMTPSDSCEPHLRPEERETCNPDPCVSQIDENCRDKYFNCNVVVQARLCVYN
YYKTACCASCTRVANRQAGFLGRR
Download sequence
Identical sequences W5NBD6
ENSLOCP00000017945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]