SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018135 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000018135
Domain Number 1 Region: 218-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-61
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 28-124
Classification Level Classification E-value
Superfamily DEATH domain 2.94e-21
Family DEATH domain, DD 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000018135
Domain Number - Region: 124-210
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00942
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018135   Gene: ENSLOCG00000014730   Transcript: ENSLOCT00000018167
Sequence length 529
Comment pep:known_by_projection chromosome:LepOcu1:LG1:2687685:2706759:1 gene:ENSLOCG00000014730 transcript:ENSLOCT00000018167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDGTVVSPRKALATSPGNRPEPKQTKMSAGSIEGQYLYRLPAHITTEFCKVMDSLDRS
DWLRFASRVLHDQVDLRLAERSERPTDCVLHRWGVQNGTVGELLHVLNDLKLLRARDIIL
RWSPVPPSDRPAPTPWPQPPPKPSFSDQLFSPPLKDQHQKPQSNMETRPLTPPVPRPLPR
PGPPPSALRTDGEKRLEDLDSPPRPPEWPTGVGGPPTSDPSCDTQLVHSALCWPLEEVLR
GTENFSKRLCIGEGGFGHVFRATMRNTDYAVKKLKEDSEMDWSLVKQSFRTEVEKLTQYR
HPNIVDFGGYCMERGVYCLVYVFMPNGSLEDWLQSKTGGALSWQQRVRVLLGSAKAIQFL
HESTPALIHGDVKSSNILLAEGLEPKLGDFGLARLCRAPPVRGAATSSVVRTQKVRGTLA
YLPEEYILTGELGVEIDTYSFGVVLLELLTGRRALETDGTSRTRYLVRADCPALCCSTLD
YTALCCSTPGLCCTVVHWSTLHGAVVHWSTLHCAVVHWSTLHCAVVLLD
Download sequence
Identical sequences W5NBX6
ENSLOCP00000018135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]