SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018580 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000018580
Domain Number 1 Region: 1043-1216
Classification Level Classification E-value
Superfamily RUN domain-like 1.96e-26
Family RUN domain 0.01
Further Details:      
 
Domain Number 2 Region: 696-768,805-881
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000000000353
Family RUN domain 0.017
Further Details:      
 
Domain Number 3 Region: 940-980
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.000024
Family Colipase-binding domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018580   Gene: ENSLOCG00000015096   Transcript: ENSLOCT00000018612
Sequence length 1223
Comment pep:known_by_projection chromosome:LepOcu1:LG8:986088:1032066:1 gene:ENSLOCG00000015096 transcript:ENSLOCT00000018612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GENFEQSPLKRTFKSKVLAHYPETVEWNPFDQDAVNMLCMPKGLSFRTQLDSREPQFHSY
LITREDGSRTYGFVLTFYEEVTSRQICSAMQTLYQMHQAEHAGSVCASSSCSMDSLASSL
DEGEAGPLSKPPCCGAYDAGRDTLYVSKAICLVAPLPFMHACRQFLLQLHRAVTAPQPPP
LPLESYVHNILYEVPLPPPGRSLKFHGVYEPVACQRPGPGELPLADYPLREAFELLGVEN
LLQLFTCVLLERKNLAFSRDYQRLMTVAEGVTTLLFPFQWQHVYVPILPASLLHFLDAPV
PYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIELPEDFPQFPSKLEFIQEISEVLLR
FGIPPEGRLHCSDSATRLQSLALQDLVNDGKNGNLPGDALAVFELLQGNATLARLQALAR
RSGVTVGPVGAPGRGDSKGGRLQCAEEELRDAQLNVQVREVFANRFTQMFADYEAFVIPC
AQDLESWLTGREQMQNFDKLGHWLTVAGGKHTAAMGKEETPSFSENKLDFRQVPLWLEGS
VKPLYQSVPYSASCSRGRYLSTLGYQDCIDCSYTRRERDFSKAQAIEQRLTKIDHTAIHP
HLLDMKIGQGKYEPGSFPRLQADVLSTGPTNNNRWTSRSATGQRRKDRLRQHSEHLGLDN
DLRETVLVASLSLKDPRISGSTPERFQQDQQPYQKDQLILICSVKTKRMLVEKMGHEAVE
LGHGEASITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLQYQEREERQEPSAG
SPVPLGPERRQSESGLSMPALRVSLIQDMRFVQRRRARLSLLSQLSDAWRDHSLVQWHRS
EELSILPKLYKRYAFLRCEEEKEQFLFHLLSLNAVDYFCFTSVFTTIXCWPYHVHRIEVM
PRKLSAQLATLVPQTFCVLSCELLECLLHPISHNTWNLGFQCQNLGKLTTVQIGHDNSGI
LAKWLVDCVMVRNEITGHTYSQLDFISEIERGILVVVGILMSFSSSLDEKHLHQTPGADV
LSVSRSALIAVAQIKLVSELTAAQIQEAVGEAVNNIVKHFHKPEKERGSLTVLLCGESGL
VVALEQFFHHGFKSTRIFQKNVFMWDFMERAAVYLAGPEQSEDTEELLESCRTFGQYVHA
VNGTSRSIGKDTKFQLLVCLGARDRSLPRWLPLLAECPLLERMYEEHALLRDHQAVSSLG
GVLRTLQEFNITLESSLVKGIDL
Download sequence
Identical sequences W5ND71
ENSLOCP00000018580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]