SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018688 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000018688
Domain Number 1 Region: 381-704
Classification Level Classification E-value
Superfamily DNase I-like 1.96e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000478
Further Details:      
 
Domain Number 2 Region: 4-104
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-27
Family SH2 domain 0.0000899
Further Details:      
 
Domain Number 3 Region: 1164-1224
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000137
Family SAM (sterile alpha motif) domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018688   Gene: ENSLOCG00000015182   Transcript: ENSLOCT00000018720
Sequence length 1226
Comment pep:known_by_projection chromosome:LepOcu1:LG7:46814539:46835860:-1 gene:ENSLOCG00000015182 transcript:ENSLOCT00000018720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAAWYHRDISRVQAEDLLARAGRDGSFLVRDSESVPGAYALCLLFQRHVHTYRILPDE
EGLLAVQTSQGVQANCFRTLADLVLGYQQPHKGLVTPLRYPVLREAESGNEGSDGEDEKP
GVVRSQSPAQATASSAATASCPSLPGPHLLFLQRLQDSCTGSVSRDVIGPLSEYLRNEML
LDLDGLRKGGSSLLFFNRTLSSACQGLHSEIDLTLSSLETLAKVFDHPSCPLTSSRSQGT
GKGGDLDLDSLICKISALCSLLSSLEKKVLKALQEAVSNHNLASQAAPPPEPAPPTAVHT
FQVKVVHCGRQALLVDVDAGLLVFDKKPGVGCEERVPHDKILQLVKLQSAPTRLRMVLAG
HRTSQREIVFESARKREAFCQLLQLMKMRHSPQSEPDVISVFVGTWNMGGSPPPSPLLSW
VSCSGLGRVPDESTAALPHDVYAIGTQENPQGEREWAEQLKATLKTLTHIDYKMVALQSL
WNIRLAVFVKPEHENRISHVSTAGVKTGLGNTLGNKGAVGVSFHFNGTSFGFVNCHLTSG
SEKTLRRNQNLQDILRLLSLGDRQLSYFDISLRFTHLFWFGDLNYRLDLDVQEILRHVAK
REFEELLCADQLTRERHKRKAFLHFNEEEIAFPPTYRYERGSRDCYLWQKYKSTGVRINV
PSWCDRVLWKSYPETHIKCTSYGCTDDVITSDHSPVFATFQVGVTSQFVSKKDLGSSTEQ
AWIELEGIEAIVKTSSKAKFFIEFHSYCLEDLHRSSENDTQSCEVSGFLKLGWSSKQLPK
LIPLLSDMEYLQDQHLLLSVKSCDGFESYGECCIALRSLIGSTAEQFETFLTHRGEEMGS
IRGRVRVHVPKDRLRTRERIYEWFCFEKDEKGEVRGRLSPPKTHTPSLRSEPASSGGAPS
SYTNPAYFIFEGLPALRKVEEDQLLSEREPQAVWCRNSVLQLPRVSVGASLDGKAPRRSN
FAEIEIPGCLPYYKPPREHQPQTPSSYQLFPAKDKPALASPAKPTPNPNTHVYKDHSLYE
GYGGNDSPLSHEQRKHSYTSHAMWTKGQPALPGDSTDQSRLHRGPASSAHRPPSIYSLVP
PTQSRSPALAPWIAGLQTRPSGDHSLTALQIAKSLSEVDFQPTGSEYSVPRSQGMNPNYN
IPRSSRSGKHGCFWEKEAVEARGAPETLRELLSALGLQRYLLGLSLNGWKEIDSYSGITD
EDLHAAGVINRSHRRRILENLPKIWD
Download sequence
Identical sequences W5NDH9
ENSLOCP00000018688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]