SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018758 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000018758
Domain Number 1 Region: 401-802
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-123
Family Ankyrin repeat 0.0000000000192
Further Details:      
 
Domain Number 2 Region: 45-419
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.81e-114
Family Ankyrin repeat 0.000000164
Further Details:      
 
Domain Number 3 Region: 1372-1456
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-22
Family DEATH domain, DD 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018758   Gene: ENSLOCG00000015227   Transcript: ENSLOCT00000018790
Sequence length 1858
Comment pep:known_by_projection chromosome:LepOcu1:LG1:8274572:8344554:1 gene:ENSLOCG00000015227 transcript:ENSLOCT00000018790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSPQVDTSTSFLRAARSGNLDKALDHIKNGVDINTANQNGLNGLHLASKEGHVKMVLEL
LHNGITLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHL
EVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARND
DTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGISPLH
IASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRIIEILLDHGAPIQAKTKN
GLSPIHMAAQGDHLDCVRLLLQYSAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKP
NARALNGFTPLHIACKKNHMRVMELLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILL
QRGASPNASNVKVETPLHMASRAGHAEVAQFLLQNKAQVDAKAKDDQTPLHCAARMGHKE
MVKLLLDHKANPNSATTAGHTPLHIAAREGHAATTRILLDREALQTRMTKKGFTPLHVAA
KYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDLVKLLVSKGGSPHSTARNGYT
PLHIAAKQNQLEVAGSLLQYGASANAESLQGVTPLHLAAQEGRPDMVTLLLSKQANVNLG
NKRGYFLELPTDSGGIEHCEVLLAQCLSLRCIKMGYTPLHVASHYGNIKMVKFLLQQQAN
ANCKTRAGYTPLHQAAQQGHTDIVTLLLKHGALPNETTTNGTTALAIAKRLGYISVIDVL
KLVTEETVSVSTTEKHRMSFPETVDEILDVSEDEGEELMGVEGAKYLKLDELKDQDEDFL
SPKKSLEYESGLGTASIPRVSCDALLRGAVVLSVLAVLDRFLVSFMVDARGGSMRGSRHN
GLRVIIPPRTCAAPTRITCRLIKPQKLSTPPPLVEGEGLASRIISLGPAGAQFLGPVIVE
IPHFASIGRGDRELVVLRSENGSVWKEHRNRYGDELLETILNGMDEDLESQEELGKKRIR
RIISTDFPLYFAVVSRVQQESDLIGPEGGLLTSRLVPLVQATFPETAVTKRVRLGLQAQP
VPDELVTKLLGNQATFSPVVTVEPRRRKFHRPIGLRIPLPPSWRENPRDAGEGDTTSLRL
LCSVIGGTDPAQWEDITGTTKLIYADECARFTTNVSARFWLADCPRTAEAVSFANLLYKE
LSAVPYMAKFVIFAKMNEAREGRLRCYCMTDDKMDKTLEQHENFTEVARSRDIEVLEGMP
LHLECSGNLVPVRKATQQPRSFSFQAFRDNRLPVSVKVRDSSKDPSGFLSFLRKSTKYED
SQHVLCNLNITMPPCIKVVGSEDRRRTLTPLALRERYSALSEPTMASMSAMERTELKMAL
ISEQLGLSWAELARELQFSVDDINKIRVENPNSLLEQSSALLNLWATREGKRAKMESLYA
ALKNIDRSDIVNMLEGTGPQPRVGKESRRYTDRDHLLSPSMTNGYSLVQDELLSPTSMQY
ILPSPLSTEPYWQEMSSLECAPIATTEEDTLMEMSEVQVWPSGASPSLVPVEDSSLECSN
ADDSDAALEGRGGLGMSGGGLSGSMDLVEDEAGDSDAASVNGLDRGQRSEVTRAEALGST
EGGGGGGGLSSEEGISLISGQQRVYARLSESPGLSHVAERNGDRSGGGSFLSYLQEQSGS
TWQSPPESSQSWVSQQKHSVVRAKSGQHIAGQGRRMLQAERTRAKRTLFVLLEPKMRSQT
PAGSPGLCILSDVREGDEVEDIPGEQVSEEQFTDEHGNIITKKIVRKVVRRMKDSGEGEA
QEVSVEGSLQEPEELEAEAEQFMNYAILGRESSNKSEIMDVKKGAQIVKRASLRRVKQ
Download sequence
Identical sequences W5NDP9
ENSLOCP00000018758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]