SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000018917 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000018917
Domain Number 1 Region: 4-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 121-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000002
Family EGF-type module 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000018917
Domain Number - Region: 162-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00752
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000018917   Gene: ENSLOCG00000015373   Transcript: ENSLOCT00000018949
Sequence length 321
Comment pep:known_by_projection chromosome:LepOcu1:LG16:9827:16944:1 gene:ENSLOCG00000015373 transcript:ENSLOCT00000018949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDVDECSTGAHSCGPDQMCYNTRGSFSCQCSPGYQRTGDQCVDKDECAGPSYCMHRCVNT
PGSYFCMCNTGFQLASNNHTCIDVNECEVSNPCQHQCYNMIGSYMCQCDQGYELARDSAS
CQDIDECSFSSYMCQYQCVNTPGGYSCSCPEGYQLQGTRMCQDINECDSGHNCREDEKCW
NYYGGFRCYPRNPCQEPYVRTAENRCVCPSSNVCRGLPHSIVYKYMSIPSDRSVPADIFQ
IQATNIYANTINTFRIKAGNEGGEFFLRQSSNVSAMLVMTKPLSGPREHIVDLEMITFNT
VMNYRSSSILRLTIIVGPYPF
Download sequence
Identical sequences W5NE58
ENSLOCP00000018917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]