SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019028 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000019028
Domain Number 1 Region: 311-408
Classification Level Classification E-value
Superfamily DEATH domain 2.86e-23
Family DEATH domain, DD 0.0058
Further Details:      
 
Domain Number 2 Region: 12-66
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000706
Family TNF receptor-like 0.0042
Further Details:      
 
Domain Number 3 Region: 68-129
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000144
Family TNF receptor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019028   Gene: ENSLOCG00000015460   Transcript: ENSLOCT00000019060
Sequence length 411
Comment pep:known_by_projection chromosome:LepOcu1:LG1:10887946:10898908:-1 gene:ENSLOCG00000015460 transcript:ENSLOCT00000019060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADFSNRTAQLKVCQEEEYLDGKICCKKCEAGQYVKSPCTSPSTYGQCEACADGKDYTEHA
NGLKRCIHCSRCRSDQVETVPCTIVQNRQCQCKPGYFCRPEEACEVCKKCSRCKEEMAEV
HSCNATADTVCAKPSPATEKPRLGNTDKATTSAGTVTVITIVIVIIIGIVLVISLVLWKK
RKCSHNPSPGCSSQPSDVKIPIDGAGQGSVEERQNSLNAGTEQQRRVSEGEPLLQNERLA
GATRTGIDDEDRGLGDSLSNTANSSQTSLAGLPSSACSSSTPRHSPPTQRQDLAGGRAIN
ENTYIPLEVSESLKKSFAIFTDQVGVKDRKKFLRHIGVKDNDILKAEKNIPADVDEQFYQ
LLTGWQQDKGKNASIELLLNALLELGHRHDAENIIQKVIENNYYKLNNENE
Download sequence
Identical sequences W5NEG9
ENSLOCP00000019028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]