SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019114 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000019114
Domain Number 1 Region: 90-166
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000388
Family DEATH effector domain, DED 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019114   Gene: ENSLOCG00000015531   Transcript: ENSLOCT00000019146
Sequence length 384
Comment pep:known_by_projection chromosome:LepOcu1:LG1:11505518:11510789:1 gene:ENSLOCG00000015531 transcript:ENSLOCT00000019146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQNQHNTNHSPHLLITRNLTTNPGRSHSHARGPSDSHTSYSSSSRVSAMGGVASTSTPGS
GRGPSSRRAQTGRFEPWPEEAVDSAYGLYSLHRMFDIVGAQLTHRDVRVLSFLFVDVIDE
YERGGIRNGRDFFLALERQGRCDETNFRHVLQLLRIITRHDLLPYVTLRKRQTVCPDPVD
KYLEETSVRYVSPRSAGENRGAPSQRRTGTQPLICCSPTGPQVCSGRGKPTSSAPSRKRK
RAHSATDCREKQTCDIRLRVRAEYCQHESALQGNVFSNKQEALERQFERFNQANTILKSR
DLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEE
DYQAGRRKLLRNLIIGGTGAREAS
Download sequence
Identical sequences W5NEQ5
ENSLOCP00000019114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]