SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019202 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLOCP00000019202
Domain Number - Region: 159-199
Classification Level Classification E-value
Superfamily RUN domain-like 0.0615
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019202   Gene: ENSLOCG00000015598   Transcript: ENSLOCT00000019234
Sequence length 247
Comment pep:known_by_projection chromosome:LepOcu1:LG1:12048581:12097894:-1 gene:ENSLOCG00000015598 transcript:ENSLOCT00000019234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLVVLVMRVGLDRGFCGHAHLELKHLLLVLLHNLGDWRTQLPELCLTLADLSKHHHTLL
WLVQLLPDCRERWRQLRRHLSLAIMSKLLGMQKQPGPLPRHSQLAALCPLLVLMKPAVLQ
EQLRAQRRLAQLPPLSPDTLDLQAHYLCHSLLALAGIIVGAHNLPSKQWGDLQQLCYLLE
RYVLAGIREHGHFLYRSVVKDRAARLHVIWLRLLYTNMPPQLQYLNDQEQPEERSSDCKT
RPDVEIL
Download sequence
Identical sequences W5NEZ3
ENSLOCP00000019202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]