SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019416 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000019416
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 2.73e-22
Family Caspase recruitment domain, CARD 0.00037
Further Details:      
 
Domain Number 2 Region: 113-193
Classification Level Classification E-value
Superfamily DEATH domain 3.96e-16
Family DEATH domain, DD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019416   Gene: ENSLOCG00000015772   Transcript: ENSLOCT00000019448
Sequence length 201
Comment pep:known_by_projection chromosome:LepOcu1:LG8:15500326:15517095:-1 gene:ENSLOCG00000015772 transcript:ENSLOCT00000019448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRRHKQFLREHRLELSNQLVLIDTTIVQYLYQENILTESHVEEIRSRITNKQKTLALLE
ILPTRGPRAFETFLESLKEEFPWVREKLLQDLENATSEVNSTEPLLQISEEMLNSVPSDK
QLNKLVGRLGPEWETLLLDLGLSSNDIYRCKANHCLNVQSQALAAFVLWKQKFGKRATVR
CLHNSLLTAEIDTSVVDDIFQ
Download sequence
Identical sequences W5NFK7
XP_006633431.1.81211 ENSLOCP00000019416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]