SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000019917 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000019917
Domain Number 1 Region: 140-448
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-60
Family Protein kinases, catalytic subunit 0.0005
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily DEATH domain 2.62e-28
Family DEATH domain, DD 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000019917   Gene: ENSLOCG00000016164   Transcript: ENSLOCT00000019950
Sequence length 533
Comment pep:known_by_projection chromosome:LepOcu1:LG8:25977240:25986378:1 gene:ENSLOCG00000016164 transcript:ENSLOCT00000019950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKTECLSRMTFLFDVPPSVMERLCKIIDSGDGDFGWRGLAARILPDWLEVRYMEKVCA
QGKSPARELLWSWAQKNKTVGDLLEILEEMGHQRAVQLFLPQVLGQFCSVTENSPAHRAY
FTVCSPPAPQDCHLCLVSVEHSKMPIISFSDIVMGTRNFHQDLKIGEGTFSEVYKGVIGN
QIFAVKLFKQGKQTEWKKLWKLFMSEIQVLSLYHHPNILALSGYCSEEGKYCLVYPYMSN
GSLFHRLHCPDTRALLPWQVRLRILKGTARAVQHLHTAQPCCVISGNITSANILLDEHFE
PQLSDFGMACLRPHSVNDSCTISLDTSSRSILGYLPEEYIRDGKLSVKLDVYSLGVVIME
ILTARRAVQDGPKYTRLKDMLCNVVEESGGVDACLRFLDEQAGSWPPSVSLGLFRLALEC
TAWRPKNRPTTSAVLQVLSEMRPVWCRSEDQPHTLKDLEFHKGLVPSLPEENDEMQGFGE
AQLDRASPSQHRTSRAQGGPYPWDLYCSWPVECSCTVAENGKECEECRANGFS
Download sequence
Identical sequences W5NH08
ENSLOCP00000019917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]