SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000020034 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000020034
Domain Number 1 Region: 962-1176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.22e-103
Family Thrombospondin C-terminal domain 0.00000000492
Further Details:      
 
Domain Number 2 Region: 31-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.31e-42
Family Laminin G-like module 0.00000876
Further Details:      
 
Domain Number 3 Region: 839-960
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.97e-36
Family TSP type-3 repeat 0.000000371
Further Details:      
 
Domain Number 4 Region: 767-841
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000196
Family TSP type-3 repeat 0.00041
Further Details:      
 
Domain Number 5 Region: 441-496
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000209
Family TSP-1 type 1 repeat 0.00011
Further Details:      
 
Domain Number 6 Region: 495-553
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000458
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 7 Region: 324-382
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000146
Family VWC domain 0.0021
Further Details:      
 
Domain Number 8 Region: 705-782
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000017
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 9 Region: 387-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000020034
Domain Number - Region: 554-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000020034   Gene: ENSLOCG00000016241   Transcript: ENSLOCT00000020067
Sequence length 1177
Comment pep:known_by_projection chromosome:LepOcu1:LG16:10992308:11016533:-1 gene:ENSLOCG00000016241 transcript:ENSLOCT00000020067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILRRRLLWLPVLFIICASSKAQDDEVEDNSVFDLFEISKITRKTLGAKQFRGQDPNSPA
YRFIRFDHLPHVNPAVLRQILQQMQNNEGFVFLATIRQDRGSRGTLLALEGPGSTQRQFE
IVSNGKADTLDLVYWVDGSQNVVSFEDVELSDSQWKNITLHVHGENANLYIGCTLFDSFI
LDEPFYEHLRADGSRMYVAKGSIRENHFRGLLQNVRFIFDTSVEDILRNKGCEISKPEEV
NAVSESTEIVDVSPAITTNFIGQKTDQAADFCDRSCEEFSTMFQELKGLRVVVSNLIDGL
QKVTEENGIMRNILDKMENPSEQDMCWQDGRLFEDKEDWIVDSCTKCTCKESKVVCNQIT
CPAVSCASPSFIEGECCPVCLPKDSEDGWSPWSEWTECTVTCGTGTQQRGRSCDATNNPC
VGPSIQTRRCSLGKCDSRFRQDGGWSLWSPWSSCSVTCGEGMVTRIRHCNAPMPQLGGKN
CEGSGRETQRCEAEPCPIDGGWGPWSPWATCSATCGKGLRGRTRVCNSPQPQYGGKKCMG
DPNGNESCNDHACPIDGCLSNPCFAGVECNSSPDGSWECGPCPVGFRGNGTFCEDLNECD
LVSDVCFKVNNVQRCINTDPGFHCLPCPPRYKGTQPFGMGIEAAKKNKQVCEPENPCKDK
THSCHKYAECIYLSHFSDPMYKCECKIGYAGDGIICGEDSDLDGWPNQNLVCGANATYHC
NKDNCPNLPNSGQEDFDKDGQGDACDKDDDNDSIVDERDNCPLLYNPRQFDYDKDDVGDR
CDNCPYEHNPAQIDTDNNGEGDACAIDIDGDEILNEHDNCPYVYNTDQKDTDLDKVGDQC
DNCPLVHNPDQADTDNDLVGDKCDNNQDIDEDGHQNNLDNCPYIANANQADHDKDGKGDA
CDHDDDNDGVPDDRDNCRLVPNRDQLDSDGDGRGDACKDDFDNDNIPDIFDVCPENFDIS
VTDFRKFQMVHLDPKGTTQIDPNWVVRHQGKELVQTANSDPGIAVGYDEFNAVDFSGTFY
VNTDRDDDYAGFVFGYQSSGRFYVVMWKQITQTYWEEKPSMAYGISGVSLKVVNSTTGTG
ENLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQIMA
DSGPIYDKTFAGGRLGLFVFSQELVFFSDLKYECRDN
Download sequence
Identical sequences W5NHC5
ENSLOCP00000020034 XP_006638832.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]