SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000020419 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000020419
Domain Number 1 Region: 335-461
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-25
Family Ran-binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000020419   Gene: ENSLOCG00000016533   Transcript: ENSLOCT00000020454
Sequence length 464
Comment pep:known_by_projection chromosome:LepOcu1:LG8:37084253:37098040:-1 gene:ENSLOCG00000016533 transcript:ENSLOCT00000020454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVADKELNDRNWDQEDEGEEAGTFSVASQDVLKNRAIKKAKRRNAAAEGESGGNFKG
FKGFTLSASGSAGGFAGFGNGSGLKPLSSLTNGNGSSSSTPSFSGFSSTSDSKATTESLT
FNGPASSQPQSNDVSRQSNGVTQSSSAPSSQSSSRCSREYNRQLTALNCSVRDWIAKHVN
DNPLCDLNPIFKDYERHLATIEEKYGGSSDSGSESEPGSRQAEAQPGSVPGSSGAPQQKA
TAALFSFSKEEKESSSAPAPSAPAPNVTFNFGQKVDSSALGPLPASSTASFSFSSQGTGS
LFGSQGTTPASTFSFTSAKTSAPSEEKTKDENAGDEESEEPPKPVVNEVKEDDAFFSKKC
KLFYKKENEFKEKGVGTLHLKLVADKKTQLLVRADTNLGNILLNILLQSSMPCTRMGKNN
VMVVCVPNPPVDEKNPTAPVPILIRVKTAEDADELHKLLLEKKA
Download sequence
Identical sequences W5NIG0
XP_015208479.1.81211 ENSLOCP00000020419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]