SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000020471 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000020471
Domain Number 1 Region: 563-971
Classification Level Classification E-value
Superfamily RNI-like 1.51e-35
Family 28-residue LRR 0.0058
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-18
Family Caspase recruitment domain, CARD 0.0036
Further Details:      
 
Domain Number 3 Region: 163-315
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000136
Family Nucleotide and nucleoside kinases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000020471   Gene: ENSLOCG00000016573   Transcript: ENSLOCT00000020506
Sequence length 1042
Comment pep:known_by_projection chromosome:LepOcu1:LG16:15478536:15488705:-1 gene:ENSLOCG00000016573 transcript:ENSLOCT00000020506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFIRKNYVELIERMGITITHQIADHIYSKSVIDLEEKDEIYCEKTGPKAARKIIDLIQQ
KGEKACRLFVDCLRVKDVFLFEDLLGRSLPEVPTKQNIDMMAEDLKHLYKSAYFQKFHPL
GEDIDIIFDLETTFTDAQFWKKDIWNQRKGTMTLSHFLGEFKNPTVIEGGAGKGKTTLLK
RIAALWASGETSVLNKYRLVFFISLSAAEREIYETVCEQLLRVPYEIDKETFQNSLRFLK
EEVLFLLDGYDEFKPANCPEIEDMIKHNFRFKNTVIVTTRTESVSNVRPIAEIIAEIGDL
SEENSKVIIRNILGPELSKGLLQQLENSSTMQELMKTPLFVVIACAIRLGDTSIIPKTQT
VLFRTLYDLMISKNQYKISFMTSETVQESINVCGDLALRGIFEHCFEFYLRKELHSEQED
VLLKSGLLNKYTAQRMEPVYRFFHKSFQEYIAGRRLHGLLTSAKESEMKMGYQYLNQIDN
ISDISNKYYNLLMYTCGSSTQAASIVIQHMTNVKKHGRLLGTPLETDRPHVPSDNNQEQI
SQNMEELHKLQEVSMESFVNCALNFFAESLSKNELSAEFEFFFQKKKLHISSQSIPTCLS
DFFQYLPKCLAALELIELELFGNLHCSEIPNQSKKTYIPEKAVSLFFDWSHSLNSIEVSL
NDFQRLSKKDITYLGKICCSAKSLRLLLTRSKGISGKLPDVLKMCEYNLKDLVIEETPLT
LTDEQHIVLMKQLKTLYISDLQTERLPGGLLEGIQNLQNLEKLNLINIKMAEDDAKQLAE
GVKHLQRLQELHLAKLEGIGNGLRFIIDAATSRDCCLKKMVLVNCCLTKEAVIILAENLR
NANKLESLDLFENQLEEDASGCVEKLIDKLRALPSLQTLMLPWGQNVKDSLSKLLDFLKN
LPGLQKLGLQSWHLTDKDLELLSSSIQNGHLRDLQHLDLSENCVSSQGWHRFLGALGMLK
KLRVMDLSSKEGMQPEPRLINDLGKLIFELSALRRVGLQRWHLDKEYLKCLNKGNVVFGR
EFQLLVSSDYIEEDETDEESHM
Download sequence
Identical sequences W5NIL2
XP_015218800.1.81211 XP_015218801.1.81211 XP_015218802.1.81211 XP_015218803.1.81211 ENSLOCP00000020471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]