SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156740860|ref|YP_001430989.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156740860|ref|YP_001430989.1|
Domain Number 1 Region: 1-207,1080-1196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-57
Family ABC transporter ATPase domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 481-688
Classification Level Classification E-value
Superfamily Smc hinge domain 4.05e-44
Family Smc hinge domain 0.00016
Further Details:      
 
Domain Number 3 Region: 845-944
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000732
Family FCH domain 0.061
Further Details:      
 
Weak hits

Sequence:  gi|156740860|ref|YP_001430989.1|
Domain Number - Region: 279-495
Classification Level Classification E-value
Superfamily Tropomyosin 0.00111
Family Tropomyosin 0.0054
Further Details:      
 
Domain Number - Region: 155-274
Classification Level Classification E-value
Superfamily Tropomyosin 0.00458
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156740860|ref|YP_001430989.1|
Sequence length 1200
Comment chromosome segregation protein SMC [Roseiflexus castenholzii DSM 13941]
Sequence
MYLRRLEIQGFKTFAGHTLFEFQPGVTAVVGPNGSGKSNLVDAIRWALGEQHPGTLRCKR
TEDLIFSGGGRRAPAGFAEVSLTIDNRDRLLPAPYSEVTITRRATRSGENEYFINRQRVR
LRDVQEVAAPISGAYAIINQGLVDAALNLHPLERRRLFEDAAAISVYEQRRTDAERRLRE
TGANVARCADILTELEPRLRSLKRQAALARSHRDLTAELHTLLEQYYAHLWNIARTDCAA
AERSVQALESTLAARQAEIAAASATLRHTRDHIHALRHRIGALHAESSALHTDAETVQRT
LAVGQERLTALTRQIEDQEHALRDLDHQRTAQQADQEAAAAHLAGAEQRLAQIQQEYSAH
ESRRAERLANRALLRQTLDEAHHTLMEIRAALGVVQRQMVQIADQYEHLIRERAVAEESL
AAAQETLAARRHESAQAEAQVAALERELADAALRAEQARGDVEHRRRQRAAAAETLEAAR
RRQMDLEARLETLRRLHHSYAGTFAGVRAAMQWAEAQRRTGFALVATLLRVPAELETAIE
VALGSRLQNIVVDHWEDAEAAIEALKRSGEGRATFLPLDTIRARGSNGGRAYGTVDPDDG
VLGVAANLIDVDERYRPIADMLLGRTLVVRSLAVARRELSRIGGGWTMVTLAGEQVSAAG
AVTGGAAVKESGTLRRERELRELPERLEAATRAVEQAHAHYVVASEAYAAAEQMAREAER
QQRQVQRNLDQERAAAAQAQRAVDRADAERLIRQRRIEQIDAEMTALLDRRRSVIAEHED
LTQREAAARAQVDQLQAQEAAQRAEDAADDEALAVLRARRADAEGEVRALRAVLHTGAQA
LARSNDQRRALEERIERLYHERETLTHELTHSAARHQALLEQIDALRARIDPAEAELTVL
EQQREEHETRTQNLTGALIDAESAYNRATIDAQRARDRLETLRERAAGDGIDIEAAARSH
PEPLPDGNPDTLHQRIIELKQRIARLGVINPLALEEYDEAAARYEFLSSQMHDLRAASAT
LNELIAELDTAIRTRFETTFRIVAAEFERSFTRLFGGGEARLVLINDNGGDDDDQNDARP
PGIASLGVDIIARPPGKRQQHLALLSGGERALTAAALLFAILRANPTPFCVLDEVDAALD
EANIGRFRDALTELSEKTQFIVVTHNRGTIEAADTIYGITMGDDGASRVLSLRLEEIDRP
Download sequence
Identical sequences A7NHM4
383372.Rcas_0855 gi|156740860|ref|YP_001430989.1| WP_012119401.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]