SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156740997|ref|YP_001431126.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156740997|ref|YP_001431126.1|
Domain Number 1 Region: 107-263,321-335
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000000000392
Family Tricorn protease N-terminal domain 0.042
Further Details:      
 
Domain Number 2 Region: 784-944
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000442
Family Galactose-binding domain 0.069
Further Details:      
 
Weak hits

Sequence:  gi|156740997|ref|YP_001431126.1|
Domain Number - Region: 185-425
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0209
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156740997|ref|YP_001431126.1|
Sequence length 954
Comment hypothetical protein Rcas_1000 [Roseiflexus castenholzii DSM 13941]
Sequence
MLMQRRWQPALRTILSFVLCLLLFLMSAPAQAQTPLPPLVFVARSRLATGDYLFPRDVGP
AGHLITGMTKFAPGSKLLIRDQAGQLRVLIDTARPAGDPLNPLGLRDVQSPDVSFDARRI
VFAGTFGPETFRNQPNGRPYYSWRLFEIGVDGRGLRQLTHSDRDITIPEGPANAEAYAFY
DDLFPAYLADGRIVFSSSRYPARSPYDGRRSFNLYMIDGDGGNMRRLTTERSAALHPAPL
PDGRIVFSRWWVNFNQPSERGIYNRIDNRAGMEIARDQSGRPIMVERRIQVVETAPPALA
ASQPTAPPKPTPLPTISFVEKIDPATGSIVRLTKTPAPPTPTPRARPTATPTAALPGGTP
RTIVVEQPITGYRLPDGTLVYSNTNTTFNPARGRLADGFPIRDAPNTWHLMAIEADGSGM
RRFAWTPRYASALTNDSGLDTYNAVQPAVVLSGGELLIAYTTQRDQTMAHSTLYTGVRVA
RPGIENMALNTTESIAGYRWDDGTAFRPPYALAPAGLPDGRIIFAQTAAISAPARTGTYT
DTRNGRTITLRLQSSSLRYELRTIYPNGAQNEVVPLAGLSDDYDAVEARPIVARPVGDGP
GMWRLPRGTPPPVSDDPLESNVPLGLLDTFGNPAYPWSRRSIQSVELVAVRNANVYANPP
LELPFINNSPPPGSVAFADIYIDANQFGGATSRAPNPDDQARAVKWLTVPVNPDGSFIAS
APADVPTFIVLRDKSGRIVRGGNRHTLSIAQGNSAGRPGQPMFCIGCHMGHASGSIANPS
LAERGWTNIAPAASIAASSSIENGAPARINDRRGYVTAPNGTLIDRTPPWTANGGAGQWI
RLEWQLPMAILEVRLVGAEPGQEGRSADYEVSGELRFYLRGQELGGTARSVEAVAPLSRG
GTLIRLPQPIAADRVEFTVTAVRGAQRGAPAPAALSEIEVAGQGATPDALGVGR
Download sequence
Identical sequences A7NI11
383372.Rcas_1000 gi|156740997|ref|YP_001431126.1| WP_012119538.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]