SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156741110|ref|YP_001431239.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156741110|ref|YP_001431239.1|
Domain Number 1 Region: 217-354
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000835
Family Histidine kinase 0.023
Further Details:      
 
Weak hits

Sequence:  gi|156741110|ref|YP_001431239.1|
Domain Number - Region: 182-228
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.0353
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.011
Further Details:      
 
Domain Number - Region: 8-80
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0356
Family FCH domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156741110|ref|YP_001431239.1|
Sequence length 357
Comment histidine kinase [Roseiflexus castenholzii DSM 13941]
Sequence
MTDAPPSLKELYDKANADLEKARRELNEIEALLRQTSNEVEKLQQRELTVSNRLRDLDVN
IDRYSKADVKNYYASAQEVQMRLLTMRSQLEQLQYRQQATKQRQSLLFELITALEPLLGV
ATPAGNAGGMVGSDQLIADIIQAQEKERLRISLQMHDGPAQSMSNLVLRAEICQRLLDRD
PEMARAELGALKNAINATLQDTRRFIFDLRPMILDDLGLAPTLRRYVQQVSEKNKLEINL
MVQNLEMRLPPHYEVAIFRFIQEALNNVIKHANASQARVLVSIRDDVGAARVIHVSVEDD
GSGFHVGEVLSDDSGRRNMGIATLRQQVETLLRGEFGIESAVGRGTRVEAIIPLPAG
Download sequence
Identical sequences A7NIC1
383372.Rcas_1122 gi|156741110|ref|YP_001431239.1| WP_012119651.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]