SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156741255|ref|YP_001431384.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156741255|ref|YP_001431384.1|
Domain Number 1 Region: 67-125
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0000000405
Family F1F0 ATP synthase subunit B, membrane domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|156741255|ref|YP_001431384.1|
Domain Number - Region: 29-75,106-111
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0398
Family Arfaptin, Rac-binding fragment 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156741255|ref|YP_001431384.1|
Sequence length 163
Comment F0F1 ATP synthase subunit B [Roseiflexus castenholzii DSM 13941]
Sequence
MEKLGINWGLLIAQLINVVFVVWLLTTFLYRPILNMLNQRTNRIQEGLQDAERVREQLAN
AKRDYDAELAKARQEAASILAQAQERARAQAAEIIAQAHRDAEKIKSDTLAQAEQERQRM
LGELKDRMAELVVLTAERVLNAELKANHDRLIEESLAELGKYN
Download sequence
Identical sequences A7NIR3
WP_012119796.1.48654 383372.Rcas_1269 gi|156741255|ref|YP_001431384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]