SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156742734|ref|YP_001432863.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156742734|ref|YP_001432863.1|
Domain Number 1 Region: 523-848
Classification Level Classification E-value
Superfamily DNase I-like 4.06e-36
Family Sphingomyelin phosphodiesterase-like 0.046
Further Details:      
 
Domain Number 2 Region: 872-1010,1044-1267
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.14e-18
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.028
Further Details:      
 
Weak hits

Sequence:  gi|156742734|ref|YP_001432863.1|
Domain Number - Region: 111-221
Classification Level Classification E-value
Superfamily Sialidases 0.00458
Family Sialidases (neuraminidases) 0.017
Further Details:      
 
Domain Number - Region: 19-71
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0212
Family ArgJ-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156742734|ref|YP_001432863.1|
Sequence length 1641
Comment endonuclease/exonuclease/phosphatase [Roseiflexus castenholzii DSM 13941]
Sequence
MVLSRHHPPMTLRLLLALTTLALLLTSALVAPQRAAATTTIITQWTFNSNPPDGNTATGT
TIPAIGSGTASLVGGTTATFASGDASGGSTDPNTGDDSAWNTTTYAPQGTEDRQRGAQFA
VSTVGYENISFSFDLRHSNTAANAVALLYSTDGGMTFSEATTFTATAGDAWFNNRAFDFS
GIPALNNNPNVVFRVVAAFASGSSVYAPSNPGSTYGTSGTLRFDMVTVRGNPISSATPTP
SPTPEPTPTPVACSAPDTPINQVQGNGATTPLSGTVVTIQGVVVGDYEGPAPNLRGFYLQ
EIAQVDANPLTSEGVFVFNGNTNAVSLGQVVQVTGAATEFQDQTQIGNVTAIEFCGGTAT
VAPVDVVMPFPSADYLERYEGMLVRFPQTLYVTEHFQLGRFGQVVMSSDARLRQPTDVVD
PGPAALALQAANDLNRIIVDDELNNQNPDPIRFGRGGNPLSAGNTLRGGDTATGIVGVLT
YTWAGNPASGNAYRLRPINALGGGAPNFVAANPRPDLPPAVGGDLRVAAFNVLNYFNTFS
GCTFGVGGPPADCRGAENATEFTRQNAKLIPALLRLDADVLGLIEIENDGYGPTSALAEL
VNRLNAATAPGTYAFIDVDAATGQTNALGTDAIKVAILYKPAVVTPVGQTAALNTVAFVN
GGDSAPRNRPALAQTFRHRATGEDVTVVVNHFKSKGSPCDAPDAGDGAGNCNIVRRNAAQ
ELVAWLAGNPTGTGDNDILILGDLNSYAQEDPIDVLRAAGYTDLAQTFIGDEAYSYVFNG
QWGYLDYALASPSALAKVSGVVEYHINADEPSVLDYNTNFKSAGQQVSLFATDQYRTSDH
DPILVGLNLNDPIALSAVATFGADRGITGAEIIDIRGDRAVLSNADAGTVYVLDTTDLLN
IRVLATVTGLTGLNAVAIHPTQDYFLAVAGSAAPAAAPLNGAVFAYRLDGTIIASATTGI
QPDSVAISPNGQYAVIANEAEGFAVGDNGGPGSLTVVNLSGFDPDSSTSLSVAQIALPSL
ASTPGFTLNRTDDIARLPIDNTPATLEPESVTFSADSQYAYISLQENNGVARLNLVDNSL
TFFGLGQATHVFDTVNGGGFNPTRLLSLFREPDGIAFIEIGGNGYVVTADEGDTRDDVPS
GAISGRVRGGRTVSVFDATTGALVGDSGNQIDALAARYGIYPDSRSDRGGAEPEVLDANV
FGGRVIVAVGLERANAIALVDITNPAAPNVFQIIPAGAAPEGVKLVERNGTLYALAANEA
SNTLTVARAPLGDVLFTQTYTEETPLALHDPFVIDPDSAPVTVTLSLSPATAGTLNTAAL
NGTPAVVNAALANLVFTPAPNNAGPVTITVNATDGRTETGGLILLSGIPTPPVTTASVSG
PTTPRCPADCFFGSATVSLTTDEPATTQYRVNGGSWQTYTAPFAITTEGTNLVEFFSTDE
WGAAESVKSITVKVTTFPATGILDAFNRANGRLGRSWTGATQLDQYRIAGNQVDVEKGGA
VLWRTQFGNDQEAFFTLTSIDPNSPHHTLLLKGRGTNATQGAILVSYDAVNRQIVVEALQ
PGQGWRTVRIFPNITLNAGDVLGARALTDGSVRVYVNCELIGVADTTTVVGNLYVNRGGR
IGLFYHQASNATLDDFGGGNR
Download sequence
Identical sequences A7NMS4
WP_012121269.1.48654 383372.Rcas_2774 gi|156742734|ref|YP_001432863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]