SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156742834|ref|YP_001432963.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156742834|ref|YP_001432963.1|
Domain Number 1 Region: 91-164
Classification Level Classification E-value
Superfamily Single hybrid motif 4.84e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.00059
Further Details:      
 
Weak hits

Sequence:  gi|156742834|ref|YP_001432963.1|
Domain Number - Region: 9-85
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0115
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156742834|ref|YP_001432963.1|
Sequence length 164
Comment biotin/lipoyl attachment domain-containing protein [Roseiflexus castenholzii DSM 13941]
Sequence
MSKLSITIDGHTFVVESPPLHRTTGAITVRVDGQSVQVLTPETGSPELLDWLIVERRPYE
VAVDPNLRWMRSRFGLHQVEVRDLEATVARPASGDGRIKAPIPGLITRVLVSPGEAVELG
QPLLVLEAMKMENEIRAPRAGRVTQIHVAPGQSVALGVVMAEVE
Download sequence
Identical sequences A7NN13
gi|156742834|ref|YP_001432963.1| 383372.Rcas_2883 WP_012121369.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]